DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpS7 and Mrps7

DIOPT Version :9

Sequence 1:NP_001260339.1 Gene:mRpS7 / 34412 FlyBaseID:FBgn0032236 Length:218 Species:Drosophila melanogaster
Sequence 2:NP_001093941.1 Gene:Mrps7 / 113958 RGDID:1309164 Length:242 Species:Rattus norvegicus


Alignment Length:207 Identity:86/207 - (41%)
Similarity:125/207 - (60%) Gaps:10/207 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SVYPTHYVEPIVQK---YKQL-----EQKNDLSKLYHVPIKAAVNKSSDTIFHDDTKHKMINYIT 77
            |.|...:.:|::.|   .||:     |:|.||.......||||....:.::|.|....|..|.:.
  Rat    35 SRYAPEFRDPLIDKEHYRKQVSELTEEEKYDLELKKTQLIKAAAATETSSVFADPVISKFTNMMM 99

  Fly    78 KKGNSALARTLLSKTLELIKRTQTEHMNLAKG-EKTTINTNPETLLKQAVENCRPLLQVTAIKRG 141
            |.||..|||:|:::|||.:||.|.|....|.. |:.||..||..:..:|:.||.|::.:..|.:|
  Rat   100 KGGNKVLARSLMAQTLEAVKRKQFEKYRAASAEEQATIERNPYKIFHEALRNCEPVIGLVPILKG 164

  Fly   142 GVTYQVPVPITTKRSYFLAMKWLLEAARE-KERKVSLPEKLAWEILDAAHGQGRVIKRKDDLHRL 205
            |..||||||:..:|..||||||::...|| |.|::.:||||:.|:|:|.|.:|.|||||.::|::
  Rat   165 GHFYQVPVPLADRRRRFLAMKWMITECRENKPRRMLMPEKLSHELLEAFHNRGPVIKRKHNMHKM 229

  Fly   206 CESNRAYAHYRW 217
            .|:|||.|||||
  Rat   230 AEANRALAHYRW 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpS7NP_001260339.1 uS7_Mitochondria_Mammalian 21..216 CDD:271249 83/204 (41%)
Mrps7NP_001093941.1 uS7_Mitochondria_Mammalian 35..240 CDD:271249 83/204 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341566
Domainoid 1 1.000 133 1.000 Domainoid score I4934
eggNOG 1 0.900 - - E1_COG0049
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9321
Inparanoid 1 1.050 157 1.000 Inparanoid score I4189
OMA 1 1.010 - - QHG45686
OrthoDB 1 1.010 - - D1212658at2759
OrthoFinder 1 1.000 - - FOG0003102
OrthoInspector 1 1.000 - - oto95802
orthoMCL 1 0.900 - - OOG6_102117
Panther 1 1.100 - - LDO PTHR11205
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4022
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.