DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk1 and Cdk4

DIOPT Version :9

Sequence 1:NP_476797.1 Gene:Cdk1 / 34411 FlyBaseID:FBgn0004106 Length:297 Species:Drosophila melanogaster
Sequence 2:XP_038935924.1 Gene:Cdk4 / 94201 RGDID:621120 Length:313 Species:Rattus norvegicus


Alignment Length:229 Identity:92/229 - (40%)
Similarity:139/229 - (60%) Gaps:5/229 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 VCLEDVLMEENRIYLIFEFLSMDLKKYMDSLPVDKHMESELVRSYLYQITSAILFCHRRRVLHRD 128
            ||.......:.::.|:||.:..||:.|:|..| ...:..|.::..:.|..|.:.|.|...::|||
  Rat    87 VCATSRTDRDIKVTLVFEHIDQDLRTYLDKAP-PPGLPVETIKDLMRQFLSGLDFLHANCIVHRD 150

  Fly   129 LKPQNLLIDKSGLIKVADFGLGRSFGIPVRIYTHEIVTLWYRAPEVLLGSPRYSCPVDIWSIGCI 193
            |||:|:|:..:|.:|:|||||.|.:...:.: |..:||||||||||||.| .|:.|||:||:|||
  Rat   151 LKPENILVTSNGTVKLADFGLARIYSYQMAL-TPVVVTLWYRAPEVLLQS-TYATPVDMWSVGCI 213

  Fly   194 FAEMATRKPLFQGDSEIDQLFRMFRILKTPTEDIWPGVTSLPDYKNTFPCWSTNQLTNQLKNLDA 258
            ||||..|||||.|:||.|||.::|.::..|.||.||...|||  :..|.......:.:.:..::.
  Rat   214 FAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPREVSLP--RGAFSPRGPRPVQSVVPEMEE 276

  Fly   259 NGIDLIQKMLIYDPVHRISAKDILEHPYFNGFQS 292
            :|..|:.:||.::|:.||||...|:|.|.:..:|
  Rat   277 SGAQLLLEMLTFNPLKRISAFRALQHSYLHKEES 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk1NP_476797.1 STKc_CDK1_euk 3..287 CDD:270845 90/222 (41%)
Cdk4XP_038935924.1 PKc_like <82..305 CDD:419665 90/222 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.