DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk1 and PHO85

DIOPT Version :9

Sequence 1:NP_476797.1 Gene:Cdk1 / 34411 FlyBaseID:FBgn0004106 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_015294.1 Gene:PHO85 / 856076 SGDID:S000005952 Length:305 Species:Saccharomyces cerevisiae


Alignment Length:292 Identity:151/292 - (51%)
Similarity:200/292 - (68%) Gaps:9/292 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FEKIEKIGEGTYGVVYKGRNRLTGQIVAMKKIRLESDDEGVPSTAIREISLLKELKHENIVCLED 68
            |:::||:|.|||..||||.|:.||..||:|:::|:| :||.||||||||||:|||||||||.|.|
Yeast     7 FKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDS-EEGTPSTAIREISLMKELKHENIVRLYD 70

  Fly    69 VLMEENRIYLIFEFLSMDLKKYMDSLPV---DKHMESELVRSYLYQITSAILFCHRRRVLHRDLK 130
            |:..||::.|:|||:..||||||||..|   .:.:|..||:.:.:|:...:.|||..::||||||
Yeast    71 VIHTENKLTLVFEFMDNDLKKYMDSRTVGNTPRGLELNLVKYFQWQLLQGLAFCHENKILHRDLK 135

  Fly   131 PQNLLIDKSGLIKVADFGLGRSFGIPVRIYTHEIVTLWYRAPEVLLGSPRYSCPVDIWSIGCIFA 195
            ||||||:|.|.:|:.||||.|:|||||..::.|:||||||||:||:||..||..:||||.|||.|
Yeast   136 PQNLLINKRGQLKLGDFGLARAFGIPVNTFSSEVVTLWYRAPDVLMGSRTYSTSIDIWSCGCILA 200

  Fly   196 EMATRKPLFQGDSEIDQLFRMFRILKTPTEDIWPGVTSLPDYKNTFPCWSTNQLTNQL-----KN 255
            ||.|.||||.|.::.:||..:|.|:.||.|.:||.||.||.|...........|...|     :.
Yeast   201 EMITGKPLFPGTNDEEQLKLIFDIMGTPNESLWPSVTKLPKYNPNIQQRPPRDLRQVLQPHTKEP 265

  Fly   256 LDANGIDLIQKMLIYDPVHRISAKDILEHPYF 287
            ||.|.:|.:..:|..:|..|:|||..|.||:|
Yeast   266 LDGNLMDFLHGLLQLNPDMRLSAKQALHHPWF 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk1NP_476797.1 STKc_CDK1_euk 3..287 CDD:270845 150/290 (52%)
PHO85NP_015294.1 PKc_like 6..297 CDD:419665 150/290 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000411
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100334
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R185
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.700

Return to query results.
Submit another query.