DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk1 and CTK1

DIOPT Version :9

Sequence 1:NP_476797.1 Gene:Cdk1 / 34411 FlyBaseID:FBgn0004106 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_012783.1 Gene:CTK1 / 853718 SGDID:S000001622 Length:528 Species:Saccharomyces cerevisiae


Alignment Length:294 Identity:106/294 - (36%)
Similarity:170/294 - (57%) Gaps:21/294 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KIEKIGEGTYGVVYKGRNRLTGQIVAMKKIRLESDDEGVPSTAIREISLLKELKHENIVCLEDVL 70
            :|.::||||||.|||.:|..|.::||:||:||:.:.||.|.|:||||.||:...|.|:..:::::
Yeast   185 RIMQVGEGTYGKVYKAKNTNTEKLVALKKLRLQGEREGFPITSIREIKLLQSFDHPNVSTIKEIM 249

  Fly    71 MEENR-IYLIFEFLSMDL------KKYMDSLPVDKHMESELVRSYLYQITSAILFCHRRRVLHRD 128
            :|..: :|:|||:...||      |:...|....||:..:|:....|        .|..::||||
Yeast   250 VESQKTVYMIFEYADNDLSGLLLNKEVQISHSQCKHLFKQLLLGMEY--------LHDNKILHRD 306

  Fly   129 LKPQNLLIDKSGLIKVADFGLGRSFGIPVRIYTHEIVTLWYRAPEVLLGSPRYSCPVDIWSIGCI 193
            :|..|:|||..|.:|:.||||.|....... ||:.::|||||.||:|||:..|...||:|..||:
Yeast   307 VKGSNILIDNQGNLKITDFGLARKMNSRAD-YTNRVITLWYRPPELLLGTTNYGTEVDMWGCGCL 370

  Fly   194 FAEMATRKPLFQGDSEIDQLFRMFRILKTPTEDIWPGVTSLPDYKNTFPCWST---NQLTNQLKN 255
            ..|:..:..:|||.:|::|:..:|:|:.|||.:.||.:..:|.:....|..:|   |..:.:.|:
Yeast   371 LVELFNKTAIFQGSNELEQIESIFKIMGTPTINSWPTLYDMPWFFMIMPQQTTKYVNNFSEKFKS 435

  Fly   256 L--DANGIDLIQKMLIYDPVHRISAKDILEHPYF 287
            :  .:..:.|...:|.||...|.||.:.|:..||
Yeast   436 VLPSSKCLQLAINLLCYDQTKRFSATEALQSDYF 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk1NP_476797.1 STKc_CDK1_euk 3..287 CDD:270845 104/292 (36%)
CTK1NP_012783.1 STKc_CDK9_like 183..469 CDD:270832 104/292 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.