DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk1 and CDC28

DIOPT Version :9

Sequence 1:NP_476797.1 Gene:Cdk1 / 34411 FlyBaseID:FBgn0004106 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_009718.3 Gene:CDC28 / 852457 SGDID:S000000364 Length:298 Species:Saccharomyces cerevisiae


Alignment Length:291 Identity:170/291 - (58%)
Similarity:227/291 - (78%) Gaps:4/291 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEDFEKIEKIGEGTYGVVYKGRNRLTGQ---IVAMKKIRLESDDEGVPSTAIREISLLKELKHEN 62
            :.:::::||:||||||||||..:...||   :||:|||||||:|||||||||||||||||||.:|
Yeast     5 LANYKRLEKVGEGTYGVVYKALDLRPGQGQRVVALKKIRLESEDEGVPSTAIREISLLKELKDDN 69

  Fly    63 IVCLEDVL-MEENRIYLIFEFLSMDLKKYMDSLPVDKHMESELVRSYLYQITSAILFCHRRRVLH 126
            ||.|.|:: .:.:::||:||||.:|||:||:.:|.|:.:.:::|:.::.|:...|.:||..|:||
Yeast    70 IVRLYDIVHSDAHKLYLVFEFLDLDLKRYMEGIPKDQPLGADIVKKFMMQLCKGIAYCHSHRILH 134

  Fly   127 RDLKPQNLLIDKSGLIKVADFGLGRSFGIPVRIYTHEIVTLWYRAPEVLLGSPRYSCPVDIWSIG 191
            ||||||||||:|.|.:|:.||||.|:||:|:|.||||||||||||||||||..:||..||.||||
Yeast   135 RDLKPQNLLINKDGNLKLGDFGLARAFGVPLRAYTHEIVTLWYRAPEVLLGGKQYSTGVDTWSIG 199

  Fly   192 CIFAEMATRKPLFQGDSEIDQLFRMFRILKTPTEDIWPGVTSLPDYKNTFPCWSTNQLTNQLKNL 256
            ||||||..|||:|.|||||||:|::||:|.||.|.|||.:..|||:|.:||.|....|:..:.:|
Yeast   200 CIFAEMCNRKPIFSGDSEIDQIFKIFRVLGTPNEAIWPDIVYLPDFKPSFPQWRRKDLSQVVPSL 264

  Fly   257 DANGIDLIQKMLIYDPVHRISAKDILEHPYF 287
            |..||||:.|:|.|||::||||:....||||
Yeast   265 DPRGIDLLDKLLAYDPINRISARRAAIHPYF 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk1NP_476797.1 STKc_CDK1_euk 3..287 CDD:270845 168/287 (59%)
CDC28NP_009718.3 STKc_CDK1_CdkB_like 8..295 CDD:270829 168/286 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346226
Domainoid 1 1.000 364 1.000 Domainoid score I124
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 364 1.000 Inparanoid score I374
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000411
OrthoInspector 1 1.000 - - oto99181
orthoMCL 1 0.900 - - OOG6_100334
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R185
SonicParanoid 1 1.000 - - X960
TreeFam 1 0.960 - -
1110.680

Return to query results.
Submit another query.