DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk1 and KIN28

DIOPT Version :9

Sequence 1:NP_476797.1 Gene:Cdk1 / 34411 FlyBaseID:FBgn0004106 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_010175.1 Gene:KIN28 / 851450 SGDID:S000002266 Length:306 Species:Saccharomyces cerevisiae


Alignment Length:292 Identity:112/292 - (38%)
Similarity:165/292 - (56%) Gaps:14/292 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DFEKIEKIGEGTYGVVYKGRNRLTGQIVAMKKIRLESDDEGVPSTAIREISLLKELKHENIVCLE 67
            ::.|.:|:|||||.|||.|....||:.:|:|:|:.....:|:..:||||:..|:|::|.|::.|.
Yeast     6 EYTKEKKVGEGTYAVVYLGCQHSTGRKIAIKEIKTSEFKDGLDMSAIREVKYLQEMQHPNVIELI 70

  Fly    68 DVLMEENRIYLIFEFLSMDLK-----KYMDSLPVDKHMESELVRSYLYQITSAILFCHRRRVLHR 127
            |:.|..:.:.|:.|||..||:     |.:...|.|       :::::......:..|||..:|||
Yeast    71 DIFMAYDNLNLVLEFLPTDLEVVIKDKSILFTPAD-------IKAWMLMTLRGVYHCHRNFILHR 128

  Fly   128 DLKPQNLLIDKSGLIKVADFGLGRSFGIPVRIYTHEIVTLWYRAPEVLLGSPRYSCPVDIWSIGC 192
            ||||.|||....|.||||||||.|:...|..|.|..:||.||||||:|.|:..|:..:||||:|.
Yeast   129 DLKPNNLLFSPDGQIKVADFGLARAIPAPHEILTSNVVTRWYRAPELLFGAKHYTSAIDIWSVGV 193

  Fly   193 IFAEMATRKPLFQGDSEIDQLFRMFRILKTPTEDIWPGVTSLPDYK--NTFPCWSTNQLTNQLKN 255
            ||||:..|.|...|.:::||:...||.|.|||:..||.|:|...|.  ..:|..|.::|..:...
Yeast   194 IFAELMLRIPYLPGQNDVDQMEVTFRALGTPTDRDWPEVSSFMTYNKLQIYPPPSRDELRKRFIA 258

  Fly   256 LDANGIDLIQKMLIYDPVHRISAKDILEHPYF 287
            .....:|.:..||..:|..|.:|...||..||
Yeast   259 ASEYALDFMCGMLTMNPQKRWTAVQCLESDYF 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk1NP_476797.1 STKc_CDK1_euk 3..287 CDD:270845 110/290 (38%)
KIN28NP_010175.1 STKc_CDK7 7..302 CDD:270833 112/291 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.