DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk1 and CDKB2;1

DIOPT Version :9

Sequence 1:NP_476797.1 Gene:Cdk1 / 34411 FlyBaseID:FBgn0004106 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_177780.1 Gene:CDKB2;1 / 843987 AraportID:AT1G76540 Length:313 Species:Arabidopsis thaliana


Alignment Length:296 Identity:149/296 - (50%)
Similarity:218/296 - (73%) Gaps:9/296 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEDFEKIEKIGEGTYGVVYKGRNRLTGQIVAMKKIRLESDDEGVPSTAIREISLLKELKHE-NIV 64
            |:.|||:||:||||||.||:.|.:.||:|||:||.||..|:||||||.:||||:|:.|..: ::|
plant    11 MDAFEKLEKVGEGTYGKVYRAREKATGKIVALKKTRLHEDEEGVPSTTLREISILRMLARDPHVV 75

  Fly    65 CLEDV---LMEENR--IYLIFEFLSMDLKKYMDSL-PVDKHMESELVRSYLYQITSAILFCHRRR 123
            .|.||   |.:|.:  :||:||::..|:||::.|. ...|::.::.::|.:||:...:.|||...
plant    76 RLMDVKQGLSKEGKTVLYLVFEYMDTDVKKFIRSFRSTGKNIPTQTIKSLMYQLCKGMAFCHGHG 140

  Fly   124 VLHRDLKPQNLLID-KSGLIKVADFGLGRSFGIPVRIYTHEIVTLWYRAPEVLLGSPRYSCPVDI 187
            :|||||||.|||:| |:..:|:||.||.|:|.:|::.|||||:||||||||||||:..||..||:
plant   141 ILHRDLKPHNLLMDPKTMRLKIADLGLARAFTLPMKKYTHEILTLWYRAPEVLLGATHYSTAVDM 205

  Fly   188 WSIGCIFAEMATRKPLFQGDSEIDQLFRMFRILKTPTEDIWPGVTSLPDYKNTFPCWSTNQLTNQ 252
            ||:||||||:.|.:.:||||||:.||..:|::..||.|::||||::|.:: :.:|.|..:.|::.
plant   206 WSVGCIFAELVTNQAIFQGDSELQQLLHIFKLFGTPNEEMWPGVSTLKNW-HEYPQWKPSTLSSA 269

  Fly   253 LKNLDANGIDLIQKMLIYDPVHRISAKDILEHPYFN 288
            :.|||..|:||:.|||.|:|..|||||..:|||||:
plant   270 VPNLDEAGVDLLSKMLQYEPAKRISAKMAMEHPYFD 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk1NP_476797.1 STKc_CDK1_euk 3..287 CDD:270845 146/291 (50%)
CDKB2;1NP_177780.1 PKc_like 12..305 CDD:419665 147/293 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1010560at2759
OrthoFinder 1 1.000 - - FOG0000411
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.