DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk1 and CDKB2;2

DIOPT Version :9

Sequence 1:NP_476797.1 Gene:Cdk1 / 34411 FlyBaseID:FBgn0004106 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_173517.1 Gene:CDKB2;2 / 838687 AraportID:AT1G20930 Length:315 Species:Arabidopsis thaliana


Alignment Length:296 Identity:153/296 - (51%)
Similarity:210/296 - (70%) Gaps:9/296 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEDFEKIEKIGEGTYGVVYKGRNRLTGQIVAMKKIRLESDDEGVPSTAIREISLLKELKHE-NIV 64
            ||.|||:||:||||||.||:.|.:.||.|||:||.||..|:||||.|.:||||:|:.|..: :||
plant    13 MEAFEKLEKVGEGTYGKVYRAREKATGMIVALKKTRLHEDEEGVPPTTLREISILRMLARDPHIV 77

  Fly    65 CLEDVLMEENR-----IYLIFEFLSMDLKKYMDSL-PVDKHMESELVRSYLYQITSAILFCHRRR 123
            .|.||....|:     :||:||::..||||::.|. ...:::....|:..:||:...:.|||...
plant    78 RLMDVKQGINKEGKTVLYLVFEYVDTDLKKFIRSFRQAGQNIPQNTVKCLMYQLCKGMAFCHGHG 142

  Fly   124 VLHRDLKPQNLLID-KSGLIKVADFGLGRSFGIPVRIYTHEIVTLWYRAPEVLLGSPRYSCPVDI 187
            ||||||||.|||:| |:..:|:||.||.|:|.:|::.|||||:||||||||||||:..||..||:
plant   143 VLHRDLKPHNLLMDRKTMTLKIADLGLARAFTLPMKKYTHEILTLWYRAPEVLLGATHYSTGVDM 207

  Fly   188 WSIGCIFAEMATRKPLFQGDSEIDQLFRMFRILKTPTEDIWPGVTSLPDYKNTFPCWSTNQLTNQ 252
            ||:||||||:.|::.:|.||||:.||.|:||:|.||.|::||||:.|.|: :.:|.|....|:..
plant   208 WSVGCIFAELVTKQAIFAGDSELQQLLRIFRLLGTPNEEVWPGVSKLKDW-HEYPQWKPLSLSTA 271

  Fly   253 LKNLDANGIDLIQKMLIYDPVHRISAKDILEHPYFN 288
            :.|||..|:||:.|||.|:|..|||||..:|||||:
plant   272 VPNLDEAGLDLLSKMLEYEPAKRISAKKAMEHPYFD 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk1NP_476797.1 STKc_CDK1_euk 3..287 CDD:270845 149/291 (51%)
CDKB2;2NP_173517.1 PKc_like 14..307 CDD:389743 151/293 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1010560at2759
OrthoFinder 1 1.000 - - FOG0000411
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.780

Return to query results.
Submit another query.