DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk1 and CDC2

DIOPT Version :9

Sequence 1:NP_476797.1 Gene:Cdk1 / 34411 FlyBaseID:FBgn0004106 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_566911.1 Gene:CDC2 / 824036 AraportID:AT3G48750 Length:294 Species:Arabidopsis thaliana


Alignment Length:288 Identity:185/288 - (64%)
Similarity:232/288 - (80%) Gaps:2/288 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEDFEKIEKIGEGTYGVVYKGRNRLTGQIVAMKKIRLESDDEGVPSTAIREISLLKELKHENIVC 65
            |:.:||:|||||||||||||.|:::|.:.:|:||||||.:|||||||||||||||||::|.|||.
plant     1 MDQYEKVEKIGEGTYGVVYKARDKVTNETIALKKIRLEQEDEGVPSTAIREISLLKEMQHSNIVK 65

  Fly    66 LEDVLMEENRIYLIFEFLSMDLKKYMDSLPVDKHMESELVRSYLYQITSAILFCHRRRVLHRDLK 130
            |:||:..|.|:||:||:|.:||||:|||.| |...:..::::|||||...|.:||..||||||||
plant    66 LQDVVHSEKRLYLVFEYLDLDLKKHMDSTP-DFSKDLHMIKTYLYQILRGIAYCHSHRVLHRDLK 129

  Fly   131 PQNLLID-KSGLIKVADFGLGRSFGIPVRIYTHEIVTLWYRAPEVLLGSPRYSCPVDIWSIGCIF 194
            ||||||| ::..:|:|||||.|:||||||.:|||:|||||||||:||||..||.||||||:||||
plant   130 PQNLLIDRRTNSLKLADFGLARAFGIPVRTFTHEVVTLWYRAPEILLGSHHYSTPVDIWSVGCIF 194

  Fly   195 AEMATRKPLFQGDSEIDQLFRMFRILKTPTEDIWPGVTSLPDYKNTFPCWSTNQLTNQLKNLDAN 259
            |||.::||||.|||||||||::|||:.||.||.|.|||||||||:.||.|....|...:.|||.:
plant   195 AEMISQKPLFPGDSEIDQLFKIFRIMGTPYEDTWRGVTSLPDYKSAFPKWKPTDLETFVPNLDPD 259

  Fly   260 GIDLIQKMLIYDPVHRISAKDILEHPYF 287
            |:||:.|||:.||..||:|:..|||.||
plant   260 GVDLLSKMLLMDPTKRINARAALEHEYF 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk1NP_476797.1 STKc_CDK1_euk 3..287 CDD:270845 182/284 (64%)
CDC2NP_566911.1 PLN00009 1..294 CDD:177649 185/288 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 389 1.000 Domainoid score I149
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 392 1.000 Inparanoid score I492
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1010560at2759
OrthoFinder 1 1.000 - - FOG0000411
OrthoInspector 1 1.000 - - oto3887
orthoMCL 1 0.900 - - OOG6_100334
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X960
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.730

Return to query results.
Submit another query.