DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk1 and Cdk16

DIOPT Version :9

Sequence 1:NP_476797.1 Gene:Cdk1 / 34411 FlyBaseID:FBgn0004106 Length:297 Species:Drosophila melanogaster
Sequence 2:XP_006256679.2 Gene:Cdk16 / 81741 RGDID:620584 Length:578 Species:Rattus norvegicus


Alignment Length:288 Identity:142/288 - (49%)
Similarity:209/288 - (72%) Gaps:4/288 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEDFEKIEKIGEGTYGVVYKGRNRLTGQIVAMKKIRLESDDEGVPSTAIREISLLKELKHENIVC 65
            :|.:.|::|:|||||..||||:::||..:||:|:|||| .:||.|.|||||:||||:|||.|||.
  Rat   244 LETYIKLDKLGEGTYATVYKGKSKLTDNLVALKEIRLE-HEEGAPCTAIREVSLLKDLKHANIVT 307

  Fly    66 LEDVLMEENRIYLIFEFLSMDLKKYMDSLPVDKHMESELVRSYLYQITSAILFCHRRRVLHRDLK 130
            |.|::..|..:.|:||:|..|||:|:|......:|.:  |:.:|:|:...:.:|||::|||||||
  Rat   308 LHDIIHTEKSLTLVFEYLDKDLKQYLDDCGNVINMHN--VKLFLFQLLRGLAYCHRQKVLHRDLK 370

  Fly   131 PQNLLIDKSGLIKVADFGLGRSFGIPVRIYTHEIVTLWYRAPEVLLGSPRYSCPVDIWSIGCIFA 195
            ||||||::.|.:|:|||||.|:..||.:.|::|:||||||.|::||||..||..:|:|.:||||.
  Rat   371 PQNLLINERGELKLADFGLARAKSIPTKTYSNEVVTLWYRPPDILLGSTDYSTQIDMWGVGCIFY 435

  Fly   196 EMATRKPLFQGDSEIDQLFRMFRILKTPTEDIWPGVTSLPDYKN-TFPCWSTNQLTNQLKNLDAN 259
            ||||.:|||.|.:..:||..:||||.|||||.|||:.|..:::. .:|.:....|.:....||::
  Rat   436 EMATGRPLFPGSTVEEQLHFIFRILGTPTEDTWPGILSNEEFRTYNYPKYRAEALLSHAPRLDSD 500

  Fly   260 GIDLIQKMLIYDPVHRISAKDILEHPYF 287
            |.||:.|:|.::..:||||:|.::||:|
  Rat   501 GADLLTKLLQFEGRNRISAEDAMKHPFF 528

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk1NP_476797.1 STKc_CDK1_euk 3..287 CDD:270845 140/284 (49%)
Cdk16XP_006256679.2 STKc_PCTAIRE1 244..540 CDD:270854 142/288 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1010560at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.