DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk1 and cdk17

DIOPT Version :9

Sequence 1:NP_476797.1 Gene:Cdk1 / 34411 FlyBaseID:FBgn0004106 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001188286.1 Gene:cdk17 / 798487 ZFINID:ZDB-GENE-041210-15 Length:526 Species:Danio rerio


Alignment Length:288 Identity:143/288 - (49%)
Similarity:202/288 - (70%) Gaps:4/288 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEDFEKIEKIGEGTYGVVYKGRNRLTGQIVAMKKIRLESDDEGVPSTAIREISLLKELKHENIVC 65
            :|.:.|::|:|||||..|:|||::||..:||:|:|||| .:||.|.|||||:||||:|||.|||.
Zfish   192 LETYIKLDKLGEGTYATVFKGRSKLTDNLVALKEIRLE-HEEGAPCTAIREVSLLKDLKHANIVT 255

  Fly    66 LEDVLMEENRIYLIFEFLSMDLKKYMDSLPVDKHMESELVRSYLYQITSAILFCHRRRVLHRDLK 130
            |.|::..:..:.|:||:|..|||:|||.  ....|....|:.:|:||...:.:||||:|||||||
Zfish   256 LHDIVHTDKSLTLVFEYLDKDLKQYMDD--CGNIMSMHNVKIFLFQILRGLAYCHRRKVLHRDLK 318

  Fly   131 PQNLLIDKSGLIKVADFGLGRSFGIPVRIYTHEIVTLWYRAPEVLLGSPRYSCPVDIWSIGCIFA 195
            ||||||::.|.:|:|||||.|:..:|.:.|::|:||||||.|:|||||..||..:|:|.:||||.
Zfish   319 PQNLLINERGELKLADFGLARAKSVPTKTYSNEVVTLWYRPPDVLLGSSEYSTQIDMWGVGCIFY 383

  Fly   196 EMATRKPLFQGDSEIDQLFRMFRILKTPTEDIWPGVTSLPDYKN-TFPCWSTNQLTNQLKNLDAN 259
            |||..:|||.|.:..|:|..:||:|.|||||.|||::|:.::|: .||.:......|....||..
Zfish   384 EMAAGRPLFPGSTVEDELHLIFRLLGTPTEDNWPGISSIEEFKSYNFPKYKPQPFINHAPRLDTE 448

  Fly   260 GIDLIQKMLIYDPVHRISAKDILEHPYF 287
            ||:|:...|.|:...||||.:.::|.||
Zfish   449 GIELLLSFLRYESKKRISADESMKHSYF 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk1NP_476797.1 STKc_CDK1_euk 3..287 CDD:270845 140/284 (49%)
cdk17NP_001188286.1 STKc_PCTAIRE2 188..496 CDD:143377 143/288 (50%)
PLN00009 192..481 CDD:177649 143/288 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1010560at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.