DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk1 and cdk15

DIOPT Version :9

Sequence 1:NP_476797.1 Gene:Cdk1 / 34411 FlyBaseID:FBgn0004106 Length:297 Species:Drosophila melanogaster
Sequence 2:XP_005165792.1 Gene:cdk15 / 791619 ZFINID:ZDB-GENE-060421-7193 Length:461 Species:Danio rerio


Alignment Length:293 Identity:137/293 - (46%)
Similarity:189/293 - (64%) Gaps:20/293 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IEKIGEGTYGVVYKGRNRLTGQIVAMKKIRLESDDEGVPSTAIREISLLKELKHENIVCLEDVLM 71
            :||:|||||..||||.:|:.|.:||:|.|.::: :||:|.|||||.||||.|||.|||.|.|::.
Zfish   130 LEKLGEGTYATVYKGISRINGHLVALKVIHMKT-EEGIPFTAIREASLLKGLKHANIVLLHDIIH 193

  Fly    72 EENRIYLIFEFLSMDLKKYMDSLPVDKHMESELVRSYLYQITSAILFCHRRRVLHRDLKPQNLLI 136
            ....:..:||::..||.:||...|...|  |..:|.:::|:...:.:.|.||:||||||||||||
Zfish   194 TRESLTFVFEYVQTDLAQYMIQHPGGLH--SYNIRLFMFQLLRGLSYIHGRRILHRDLKPQNLLI 256

  Fly   137 DKSGLIKVADFGLGRSFGIPVRIYTHEIVTLWYRAPEVLLGSPRYSCPVDIWSIGCIFAEMATRK 201
            ...|.:|:|||||.||..||.:.|:.|:||||||.|:||:||..||..:|||..||||.||....
Zfish   257 SYLGELKLADFGLARSKSIPCQTYSAEVVTLWYRPPDVLMGSTDYSTALDIWGAGCIFIEMLQGS 321

  Fly   202 PLFQGDSEI-DQLFRMFRILKTPTEDIWPGVTSLPDYKNTF--PC--------WSTNQLTNQLKN 255
            |.|.|.::: :||.:::.::..|||:|||||:.||:||..:  ||        |      .:|..
Zfish   322 PAFPGVADVFEQLLKIWTVIGVPTEEIWPGVSDLPNYKPEWFLPCKPQQFRDVW------KRLSQ 380

  Fly   256 LDANGIDLIQKMLIYDPVHRISAKDILEHPYFN 288
            |.....||.|:||:.:|..||||:|.|.|||||
Zfish   381 LPYKTEDLAQQMLMMNPKDRISAQDALLHPYFN 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk1NP_476797.1 STKc_CDK1_euk 3..287 CDD:270845 134/290 (46%)
cdk15XP_005165792.1 STKc_PFTAIRE2 126..412 CDD:270852 134/290 (46%)
PLN00009 127..415 CDD:177649 137/293 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1010560at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.