DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk1 and cdk5

DIOPT Version :9

Sequence 1:NP_476797.1 Gene:Cdk1 / 34411 FlyBaseID:FBgn0004106 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_571794.1 Gene:cdk5 / 65234 ZFINID:ZDB-GENE-010131-2 Length:292 Species:Danio rerio


Alignment Length:292 Identity:162/292 - (55%)
Similarity:218/292 - (74%) Gaps:5/292 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEDFEKIEKIGEGTYGVVYKGRNRLTGQIVAMKKIRLESDDEGVPSTAIREISLLKELKHENIVC 65
            |:.:||:|||||||||.|:|.:||.|.:|||:|::||:.|||||||:|:|||.|||||||:|||.
Zfish     1 MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVR 65

  Fly    66 LEDVLMEENRIYLIFEFLSMDLKKYMDSLPVDKHMESELVRSYLYQITSAILFCHRRRVLHRDLK 130
            |.|||..:.::.|:||:...|||||.||...|  ::.|:|:|::||:...:.|||.|.|||||||
Zfish    66 LHDVLHSDKKLTLVFEYCDQDLKKYFDSCNGD--LDPEIVKSFMYQLLKGLAFCHSRNVLHRDLK 128

  Fly   131 PQNLLIDKSGLIKVADFGLGRSFGIPVRIYTHEIVTLWYRAPEVLLGSPRYSCPVDIWSIGCIFA 195
            ||||||:::|.:|:|||||.|:||||||.|:.|:||||||.|:||.|:..||..:|:||.|||||
Zfish   129 PQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFA 193

  Fly   196 EMATR-KPLFQGDSEIDQLFRMFRILKTPTEDIWPGVTSLPDYKNTFPCW-STNQLTNQLKNLDA 258
            |:|.. :|||.|:...|||.|:||:|.||||:.|..:..||||| .:|.: :|..|.|.:..|.:
Zfish   194 ELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWQTMNKLPDYK-PYPMYPATTSLVNVVPKLSS 257

  Fly   259 NGIDLIQKMLIYDPVHRISAKDILEHPYFNGF 290
            .|.||:|.:|..:||.||||::.|:||||..|
Zfish   258 TGRDLLQNLLKCNPVQRISAEEALQHPYFADF 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk1NP_476797.1 STKc_CDK1_euk 3..287 CDD:270845 158/285 (55%)
cdk5NP_571794.1 STKc_CDK5 3..286 CDD:143344 158/285 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1010560at2759
OrthoFinder 1 1.000 - - FOG0000411
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100334
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R185
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.