DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk1 and CDK14

DIOPT Version :9

Sequence 1:NP_476797.1 Gene:Cdk1 / 34411 FlyBaseID:FBgn0004106 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001274064.1 Gene:CDK14 / 5218 HGNCID:8883 Length:469 Species:Homo sapiens


Alignment Length:292 Identity:137/292 - (46%)
Similarity:197/292 - (67%) Gaps:9/292 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EDFEKIEKIGEGTYGVVYKGRNRLTGQIVAMKKIRLESDDEGVPSTAIREISLLKELKHENIVCL 66
            :.:||:||:|||:|..||||::::.|::||:|.|||: ::||.|.|||||.||||.|||.|||.|
Human   133 DSYEKLEKLGEGSYATVYKGKSKVNGKLVALKVIRLQ-EEEGTPFTAIREASLLKGLKHANIVLL 196

  Fly    67 EDVLMEENRIYLIFEFLSMDLKKYMDSLPVDKHMESELVRSYLYQITSAILFCHRRRVLHRDLKP 131
            .|::..:..:.|:||::..||.:|||..|...|.::  |:.:|:|:...:.:.|:|.:|||||||
Human   197 HDIIHTKETLTLVFEYVHTDLCQYMDKHPGGLHPDN--VKLFLFQLLRGLSYIHQRYILHRDLKP 259

  Fly   132 QNLLIDKSGLIKVADFGLGRSFGIPVRIYTHEIVTLWYRAPEVLLGSPRYSCPVDIWSIGCIFAE 196
            |||||..:|.:|:|||||.|:..:|...|::|:||||||.|:|||||..||..:|:|.:||||.|
Human   260 QNLLISDTGELKLADFGLARAKSVPSHTYSNEVVTLWYRPPDVLLGSTEYSTCLDMWGVGCIFVE 324

  Fly   197 MATRKPLFQGDSEI-DQLFRMFRILKTPTEDIWPGVTSLPDYK-NTFPCWSTNQLT---NQLKNL 256
            |......|.|..:| |||.|:|.:|.||.||.||||.|||.:| ..|..:|:..|.   |:|..:
Human   325 MIQGVAAFPGMKDIQDQLERIFLVLGTPNEDTWPGVHSLPHFKPERFTLYSSKNLRQAWNKLSYV 389

  Fly   257 DANGIDLIQKMLIYDPVHRISAKDILEHPYFN 288
            : :..||..|:|...|.:|:||:..|.|.||:
Human   390 N-HAEDLASKLLQCSPKNRLSAQAALSHEYFS 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk1NP_476797.1 STKc_CDK1_euk 3..287 CDD:270845 135/288 (47%)
CDK14NP_001274064.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 103..133 137/292 (47%)
STKc_PFTAIRE1 129..431 CDD:143374 137/292 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 449..469
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1010560at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.