DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk1 and CDK18

DIOPT Version :9

Sequence 1:NP_476797.1 Gene:Cdk1 / 34411 FlyBaseID:FBgn0004106 Length:297 Species:Drosophila melanogaster
Sequence 2:XP_016856912.1 Gene:CDK18 / 5129 HGNCID:8751 Length:572 Species:Homo sapiens


Alignment Length:292 Identity:140/292 - (47%)
Similarity:204/292 - (69%) Gaps:12/292 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEDFEKIEKIGEGTYGVVYKGRNRLTGQIVAMKKIRLESDDEGVPSTAIREISLLKELKHENIVC 65
            :|.:.|::|:|||||..|:|||::||..:||:|:|||| .:||.|.|||||:||||.|||.|||.
Human   239 LETYVKLDKLGEGTYATVFKGRSKLTENLVALKEIRLE-HEEGAPCTAIREVSLLKNLKHANIVT 302

  Fly    66 LEDVLMEENRIYLIFEFLSMDLKKYMDSLPVDKH----MESELVRSYLYQITSAILFCHRRRVLH 126
            |.|::..:..:.|:||:|..|||:|:|      |    |....|:.:::|:...:.:||.|::||
Human   303 LHDLIHTDRSLTLVFEYLDSDLKQYLD------HCGNLMSMHNVKIFMFQLLRGLAYCHHRKILH 361

  Fly   127 RDLKPQNLLIDKSGLIKVADFGLGRSFGIPVRIYTHEIVTLWYRAPEVLLGSPRYSCPVDIWSIG 191
            ||||||||||::.|.:|:|||||.|:..:|.:.|::|:||||||.|:|||||..||.|:|:|.:|
Human   362 RDLKPQNLLINERGELKLADFGLARAKSVPTKTYSNEVVTLWYRPPDVLLGSTEYSTPIDMWGVG 426

  Fly   192 CIFAEMATRKPLFQGDSEIDQLFRMFRILKTPTEDIWPGVTSLPDYKN-TFPCWSTNQLTNQLKN 255
            ||..||||.:|||.|.:..::|..:||:|.||||:.|||||:..:::. :|||:....|.|....
Human   427 CIHYEMATGRPLFPGSTVKEELHLIFRLLGTPTEETWPGVTAFSEFRTYSFPCYLPQPLINHAPR 491

  Fly   256 LDANGIDLIQKMLIYDPVHRISAKDILEHPYF 287
            ||.:||.|:..:|:|:...|:||:..|.|.||
Human   492 LDTDGIHLLSSLLLYESKSRMSAEAALSHSYF 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk1NP_476797.1 STKc_CDK1_euk 3..287 CDD:270845 137/288 (48%)
CDK18XP_016856912.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1010560at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.