DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk1 and CDK17

DIOPT Version :9

Sequence 1:NP_476797.1 Gene:Cdk1 / 34411 FlyBaseID:FBgn0004106 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001163935.1 Gene:CDK17 / 5128 HGNCID:8750 Length:523 Species:Homo sapiens


Alignment Length:288 Identity:147/288 - (51%)
Similarity:206/288 - (71%) Gaps:4/288 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEDFEKIEKIGEGTYGVVYKGRNRLTGQIVAMKKIRLESDDEGVPSTAIREISLLKELKHENIVC 65
            ||.:.|:||:|||||..|||||::||..:||:|:|||| .:||.|.|||||:||||:|||.|||.
Human   189 METYIKLEKLGEGTYATVYKGRSKLTENLVALKEIRLE-HEEGAPCTAIREVSLLKDLKHANIVT 252

  Fly    66 LEDVLMEENRIYLIFEFLSMDLKKYMDSLPVDKHMESELVRSYLYQITSAILFCHRRRVLHRDLK 130
            |.|::..:..:.|:||:|..|||:|||.  ....|....|:.:||||...:.:||||:|||||||
Human   253 LHDIVHTDKSLTLVFEYLDKDLKQYMDD--CGNIMSMHNVKLFLYQILRGLAYCHRRKVLHRDLK 315

  Fly   131 PQNLLIDKSGLIKVADFGLGRSFGIPVRIYTHEIVTLWYRAPEVLLGSPRYSCPVDIWSIGCIFA 195
            ||||||::.|.:|:|||||.|:..:|.:.|::|:||||||.|:|||||..||..:|:|.:||||.
Human   316 PQNLLINEKGELKLADFGLARAKSVPTKTYSNEVVTLWYRPPDVLLGSSEYSTQIDMWGVGCIFF 380

  Fly   196 EMATRKPLFQGDSEIDQLFRMFRILKTPTEDIWPGVTSLPDYKN-TFPCWSTNQLTNQLKNLDAN 259
            |||:.:|||.|.:..|:|..:||:|.||:::.|||::|..::|| .||.:....|.|....||:.
Human   381 EMASGRPLFPGSTVEDELHLIFRLLGTPSQETWPGISSNEEFKNYNFPKYKPQPLINHAPRLDSE 445

  Fly   260 GIDLIQKMLIYDPVHRISAKDILEHPYF 287
            ||:||.|.|.|:...|:||::.::|.||
Human   446 GIELITKFLQYESKKRVSAEEAMKHVYF 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk1NP_476797.1 STKc_CDK1_euk 3..287 CDD:270845 143/284 (50%)
CDK17NP_001163935.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 30..55
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 103..123
STKc_PCTAIRE2 185..493 CDD:143377 147/288 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1010560at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.