DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk1 and cdk2

DIOPT Version :9

Sequence 1:NP_476797.1 Gene:Cdk1 / 34411 FlyBaseID:FBgn0004106 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001008136.1 Gene:cdk2 / 493498 XenbaseID:XB-GENE-1001990 Length:297 Species:Xenopus tropicalis


Alignment Length:287 Identity:185/287 - (64%)
Similarity:223/287 - (77%) Gaps:1/287 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEDFEKIEKIGEGTYGVVYKGRNRLTGQIVAMKKIRLESDDEGVPSTAIREISLLKELKHENIVC 65
            ||:|:|:|||||||||||||.|||.||:|||:|||||:::.|||||||||||||||||.|.|||.
 Frog     1 MENFQKVEKIGEGTYGVVYKARNRETGEIVALKKIRLDTETEGVPSTAIREISLLKELNHPNIVK 65

  Fly    66 LEDVLMEENRIYLIFEFLSMDLKKYMDSLPVDKHMESELVRSYLYQITSAILFCHRRRVLHRDLK 130
            |.||:..||::||:||||:.||||:||...: ..:...||:|||:|:...:.|||..||||||||
 Frog    66 LLDVIHTENKLYLVFEFLNQDLKKFMDGSNI-SGISLALVKSYLFQLLQGLAFCHSHRVLHRDLK 129

  Fly   131 PQNLLIDKSGLIKVADFGLGRSFGIPVRIYTHEIVTLWYRAPEVLLGSPRYSCPVDIWSIGCIFA 195
            ||||||:..|.||:|||||.|:||:|||.||||:|||||||||:|||...||..|||||:|||||
 Frog   130 PQNLLINSEGAIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKFYSTAVDIWSLGCIFA 194

  Fly   196 EMATRKPLFQGDSEIDQLFRMFRILKTPTEDIWPGVTSLPDYKNTFPCWSTNQLTNQLKNLDANG 260
            ||.||:.||.||||||||||:||.|.||.|..|||||::||||:|||.|.....:..:..||.:|
 Frog   195 EMITRRALFPGDSEIDQLFRIFRTLGTPDEVSWPGVTTMPDYKSTFPKWVRQDFSKVVPPLDDDG 259

  Fly   261 IDLIQKMLIYDPVHRISAKDILEHPYF 287
            .||:.:||.||...|||||..|.|.:|
 Frog   260 RDLLAQMLQYDSNKRISAKAALTHAFF 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk1NP_476797.1 STKc_CDK1_euk 3..287 CDD:270845 182/283 (64%)
cdk2NP_001008136.1 STKc_CDK2_3 3..286 CDD:270844 182/283 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1010560at2759
OrthoFinder 1 1.000 - - FOG0000411
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R185
SonicParanoid 1 1.000 - - X960
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.040

Return to query results.
Submit another query.