DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk1 and CG6800

DIOPT Version :9

Sequence 1:NP_476797.1 Gene:Cdk1 / 34411 FlyBaseID:FBgn0004106 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_650984.1 Gene:CG6800 / 42562 FlyBaseID:FBgn0038902 Length:302 Species:Drosophila melanogaster


Alignment Length:299 Identity:105/299 - (35%)
Similarity:168/299 - (56%) Gaps:29/299 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MED-----FEKIEKIGEGTYGVVYKGRNRLTGQIVAMKKIRLESDDEGVPSTAIREISLLKELKH 60
            |||     ::.:||||||.:|.|:|..:....:.||:||:.|::....:....:|||..|:..|.
  Fly     1 MEDYAPSRYKMLEKIGEGVHGCVFKAIDLQRNKEVAIKKVALKNKFGNIALNTLREIKTLQLCKS 65

  Fly    61 ENIVCLEDVLMEENRIYLIFEF----LSMDLKKYMDSLPVDKHMESELVRSYLYQITSAILFCHR 121
            |.|:.:.|:..:...:.|:.|:    |...||..::.|      ..:.||.:.:|:...|.:.|.
  Fly    66 EYILDIIDIYPDLTGLSLVLEYQPDTLYNRLKSEVNPL------SRQQVRKFAHQMFKGIAYLHE 124

  Fly   122 RRVLHRDLKPQNLLIDKSGLIKVADFGLGRSFGIP---VRIYTHEIVTLWYRAPEVLLGSPRYSC 183
            ..::|||:||.||||..:.::|:|||||.|.: .|   .|:|:.::.|.||||||:|.||.:|..
  Fly   125 AGLMHRDIKPANLLISDTDMLKIADFGLARLY-FPEDESRLYSPQVSTRWYRAPEILFGSQKYGT 188

  Fly   184 PVDIWSIGCIFAEMATRKPLFQGDSEIDQLFRMFRILKTPTEDIWPGVTSLPDY-KNTFPCWSTN 247
            .||:|:.||:.|||....|||.|.::|:||..:.|.|.:|..:.||.:|||||| |..||    |
  Fly   189 GVDMWAAGCVVAEMLRGVPLFAGTTDIEQLAIIIRTLGSPRLNQWPELTSLPDYSKIRFP----N 249

  Fly   248 QLTNQLKNL-----DANGIDLIQKMLIYDPVHRISAKDI 281
            .:.....||     .|..|:|:..:::|:|.:|:.|.::
  Fly   250 SVGIHWDNLFPSCTHAVEINLVSNLVVYNPKNRLKASEV 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk1NP_476797.1 STKc_CDK1_euk 3..287 CDD:270845 103/297 (35%)
CG6800NP_650984.1 STKc_CCRK 8..295 CDD:270826 102/292 (35%)
S_TKc 9..288 CDD:214567 102/289 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442459
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24056
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.