DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk1 and Cdk2

DIOPT Version :9

Sequence 1:NP_476797.1 Gene:Cdk1 / 34411 FlyBaseID:FBgn0004106 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001163666.1 Gene:Cdk2 / 42453 FlyBaseID:FBgn0004107 Length:314 Species:Drosophila melanogaster


Alignment Length:292 Identity:174/292 - (59%)
Similarity:219/292 - (75%) Gaps:6/292 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEDFEKIEKIGEGTYGVVYKGRNRLTGQIVAMKKIRLESDDEGVPSTAIREISLLKELKHENIVC 65
            :::|::.|||||||||:|||.|:..|||.||:||||||.:.|||||||||||||||.|||.|:|.
  Fly     5 LDNFQRAEKIGEGTYGIVYKARSNSTGQDVALKKIRLEGETEGVPSTAIREISLLKNLKHPNVVQ 69

  Fly    66 LEDVLMEENRIYLIFEFLSMDLKKYMDSLPVDKHM-ESELVRSYLYQITSAILFCHRRRVLHRDL 129
            |.||::..|.:|:|||:|:|||||.||.   .|.: ..:|::||::||..|:.|||..|:|||||
  Fly    70 LFDVVISGNNLYMIFEYLNMDLKKLMDK---KKDVFTPQLIKSYMHQILDAVGFCHTNRILHRDL 131

  Fly   130 KPQNLLIDKSGLIKVADFGLGRSFGIPVRIYTHEIVTLWYRAPEVLLGSPRYSCPVDIWSIGCIF 194
            ||||||:|.:|.||:|||||.|:|.:|:|.||||:|||||||||:|||:..||..|||||:||||
  Fly   132 KPQNLLVDTAGKIKLADFGLARAFNVPMRAYTHEVVTLWYRAPEILLGTKFYSTGVDIWSLGCIF 196

  Fly   195 AEMATRKPLFQGDSEIDQLFRMFRILKTPTEDIWPGVTSLPDYKNTFPCWSTNQLTNQLKNLDAN 259
            :||..|:.||.||||||||:|:||.|.||.|..|||||.|||:|..||.|....:...:...:|:
  Fly   197 SEMIMRRSLFPGDSEIDQLYRIFRTLSTPDETNWPGVTQLPDFKTKFPRWEGTNMPQPITEHEAH 261

  Fly   260 GIDLIQKMLIYDPVHRISAKDILEHPYFNGFQ 291
              :||..||.|||..||||||.|:|.||...|
  Fly   262 --ELIMSMLCYDPNLRISAKDALQHAYFRNVQ 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk1NP_476797.1 STKc_CDK1_euk 3..287 CDD:270845 171/284 (60%)
Cdk2NP_001163666.1 PLN00009 5..293 CDD:177649 174/292 (60%)
STKc_CDK1_CdkB_like 8..287 CDD:270829 171/283 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469150
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1010560at2759
OrthoFinder 1 1.000 - - FOG0000411
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100334
Panther 1 1.100 - - P PTHR24056
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R185
SonicParanoid 1 1.000 - - X960
98.780

Return to query results.
Submit another query.