DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk1 and cdk2

DIOPT Version :9

Sequence 1:NP_476797.1 Gene:Cdk1 / 34411 FlyBaseID:FBgn0004106 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_998571.1 Gene:cdk2 / 406715 ZFINID:ZDB-GENE-040426-2741 Length:298 Species:Danio rerio


Alignment Length:287 Identity:186/287 - (64%)
Similarity:226/287 - (78%) Gaps:1/287 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEDFEKIEKIGEGTYGVVYKGRNRLTGQIVAMKKIRLESDDEGVPSTAIREISLLKELKHENIVC 65
            ||.|:|:|||||||||||||.:|::||:.||:|||||:::.|||||||||||||||||.|.|||.
Zfish     1 MESFQKVEKIGEGTYGVVYKAKNKVTGETVALKKIRLDTETEGVPSTAIREISLLKELNHPNIVK 65

  Fly    66 LEDVLMEENRIYLIFEFLSMDLKKYMDSLPVDKHMESELVRSYLYQITSAILFCHRRRVLHRDLK 130
            |.||:..||::||:||||..|||::|||..| ..:...||:|||:|:...:.|||..||||||||
Zfish    66 LRDVIHTENKLYLVFEFLHQDLKRFMDSTSV-SGISLPLVKSYLFQLLQGLAFCHSHRVLHRDLK 129

  Fly   131 PQNLLIDKSGLIKVADFGLGRSFGIPVRIYTHEIVTLWYRAPEVLLGSPRYSCPVDIWSIGCIFA 195
            ||||||:..|.||:|||||.|:||:|||.||||:|||||||||:|||...||..|||||:|||||
Zfish   130 PQNLLINAQGEIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFA 194

  Fly   196 EMATRKPLFQGDSEIDQLFRMFRILKTPTEDIWPGVTSLPDYKNTFPCWSTNQLTNQLKNLDANG 260
            ||.||:.||.||||||||||:||.|.||.|.|||||||:||||.:||.|:...|:..:..||.:|
Zfish   195 EMITRRALFPGDSEIDQLFRIFRTLGTPDESIWPGVTSMPDYKPSFPKWARQDLSKVVPPLDEDG 259

  Fly   261 IDLIQKMLIYDPVHRISAKDILEHPYF 287
            .||:.:||.|||..|||||:.|.|.:|
Zfish   260 RDLLGQMLTYDPNKRISAKNALVHRFF 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk1NP_476797.1 STKc_CDK1_euk 3..287 CDD:270845 183/283 (65%)
cdk2NP_998571.1 PLN00009 1..291 CDD:177649 186/287 (65%)
STKc_CDK2_3 3..286 CDD:270844 183/283 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1010560at2759
OrthoFinder 1 1.000 - - FOG0000411
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100334
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R185
SonicParanoid 1 1.000 - - X960
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.