DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk1 and Cdk9

DIOPT Version :9

Sequence 1:NP_476797.1 Gene:Cdk1 / 34411 FlyBaseID:FBgn0004106 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_477226.2 Gene:Cdk9 / 37586 FlyBaseID:FBgn0019949 Length:404 Species:Drosophila melanogaster


Alignment Length:300 Identity:120/300 - (40%)
Similarity:180/300 - (60%) Gaps:18/300 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FEKIEKIGEGTYGVVYKGRNRL-TGQIVAMKKIRLESDDEGVPSTAIREISLLKELKHENIVCLE 67
            :||:.|||:||:|.|:|.|.:. ..:.|||||:.::::.||.|.||:|||.:|:.|||||:|.|.
  Fly    50 YEKVAKIGQGTFGEVFKAREKKGNKKFVAMKKVLMDNEKEGFPITALREIRILQLLKHENVVNLI 114

  Fly    68 DVLMEE--------NRIYLIFEFLSMDLKKYMDSLPVDKHMESELVRSYLYQITSAILFCHRRRV 124
            ::...:        :..||:|:|...||...:.::.| |....| ::..:.|:.:.:.:.|..::
  Fly   115 EICRTKATATNGYRSTFYLVFDFCEHDLAGLLSNMNV-KFSLGE-IKKVMQQLLNGLYYIHSNKI 177

  Fly   125 LHRDLKPQNLLIDKSGLIKVADFGLGRSFGIP----VRIYTHEIVTLWYRAPEVLLGSPRYSCPV 185
            ||||:|..|:||.|.|::|:|||||.|:|.||    ...||:.:||||||.||:|||...|..||
  Fly   178 LHRDMKAANVLITKHGILKLADFGLARAFSIPKNESKNRYTNRVVTLWYRPPELLLGDRNYGPPV 242

  Fly   186 DIWSIGCIFAEMATRKPLFQGDSEIDQLFRMFRILKTPTEDIWPGVTSLPDYKN-TFPCWSTNQL 249
            |:|..|||.|||.||.|:.||::|..||..:.::..:.|.|:||||..|..||: ..|.....::
  Fly   243 DMWGAGCIMAEMWTRSPIMQGNTEQQQLTFISQLCGSFTPDVWPGVEELELYKSIELPKNQKRRV 307

  Fly   250 TNQLKNL--DANGIDLIQKMLIYDPVHRISAKDILEHPYF 287
            ..:|:..  |..|.||:.|:|..||..||.|...|.|.:|
  Fly   308 KERLRPYVKDQTGCDLLDKLLTLDPKKRIDADTALNHDFF 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk1NP_476797.1 STKc_CDK1_euk 3..287 CDD:270845 119/298 (40%)
Cdk9NP_477226.2 STKc_CDK9 37..347 CDD:270848 119/298 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442447
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24056
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.