DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk1 and Cdk2

DIOPT Version :9

Sequence 1:NP_476797.1 Gene:Cdk1 / 34411 FlyBaseID:FBgn0004106 Length:297 Species:Drosophila melanogaster
Sequence 2:XP_006240840.1 Gene:Cdk2 / 362817 RGDID:70486 Length:346 Species:Rattus norvegicus


Alignment Length:340 Identity:184/340 - (54%)
Similarity:227/340 - (66%) Gaps:59/340 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEDFEKIEKIGEGTYGVVYKGRNRLTGQIVAMKKIRLESDDEGVPSTAIREISLLKELKHENIVC 65
            ||:|:|:|||||||||||||.:|:|||::||:|||||:::.|||||||||||||||||.|.|||.
  Rat     1 MENFQKVEKIGEGTYGVVYKAKNKLTGEVVALKKIRLDTETEGVPSTAIREISLLKELNHPNIVK 65

  Fly    66 LEDVLMEENRIYLIFEFLSMDLKKYMDS-----LPVDKHMESELVRSYLYQITSAILFCHRRRVL 125
            |.||:..||::||:||||..||||:||:     :|:      .|::|||:|:...:.|||..|||
  Rat    66 LLDVIHTENKLYLVFEFLHQDLKKFMDASALTGIPL------PLIKSYLFQLLQGLAFCHSHRVL 124

  Fly   126 HRDLKPQNLLIDKSGLIKVADFGLGRSFGIPVRIYTHEIVTLWYRAPEVLLGSPRYSCPVDIWSI 190
            |||||||||||:..|.||:|||||.|:||:|||.||||:|||||||||:|||...||..|||||:
  Rat   125 HRDLKPQNLLINAEGSIKLADFGLARAFGVPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSL 189

  Fly   191 GCIFAEM------------------------------------------------ATRKPLFQGD 207
            |||||||                                                .||:.||.||
  Rat   190 GCIFAEMHLVCTQHHAKCCGEHRRNGRHSLCPLCSYLEVAASQGGGMTAVSTPYPVTRRALFPGD 254

  Fly   208 SEIDQLFRMFRILKTPTEDIWPGVTSLPDYKNTFPCWSTNQLTNQLKNLDANGIDLIQKMLIYDP 272
            ||||||||:||.|.||.|.:||||||:||||.:||.|:....:..:..||.:|..|:.:||.|||
  Rat   255 SEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDP 319

  Fly   273 VHRISAKDILEHPYF 287
            ..|||||..|.||:|
  Rat   320 NKRISAKAALAHPFF 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk1NP_476797.1 STKc_CDK1_euk 3..287 CDD:270845 181/336 (54%)
Cdk2XP_006240840.1 STKc_CDK2_3 3..334 CDD:270844 181/336 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1010560at2759
OrthoFinder 1 1.000 - - FOG0000411
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100334
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X960
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.720

Return to query results.
Submit another query.