DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk1 and Cdk14

DIOPT Version :9

Sequence 1:NP_476797.1 Gene:Cdk1 / 34411 FlyBaseID:FBgn0004106 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001382511.1 Gene:Cdk14 / 362316 RGDID:1305544 Length:469 Species:Rattus norvegicus


Alignment Length:292 Identity:137/292 - (46%)
Similarity:197/292 - (67%) Gaps:9/292 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EDFEKIEKIGEGTYGVVYKGRNRLTGQIVAMKKIRLESDDEGVPSTAIREISLLKELKHENIVCL 66
            :.:||:||:|||:|..||||::::.|::||:|.|||: ::||.|.|||||.||||.|||.|||.|
  Rat   133 DSYEKLEKLGEGSYATVYKGKSKVNGKLVALKVIRLQ-EEEGTPFTAIREASLLKGLKHANIVLL 196

  Fly    67 EDVLMEENRIYLIFEFLSMDLKKYMDSLPVDKHMESELVRSYLYQITSAILFCHRRRVLHRDLKP 131
            .|::..:..:.|:||::..||.:|||..|...|.::  |:.:|:|:...:.:.|:|.:|||||||
  Rat   197 HDIIHTKETLTLVFEYVHTDLCQYMDKHPGGLHPDN--VKLFLFQLLRGLSYIHQRYILHRDLKP 259

  Fly   132 QNLLIDKSGLIKVADFGLGRSFGIPVRIYTHEIVTLWYRAPEVLLGSPRYSCPVDIWSIGCIFAE 196
            |||||..:|.:|:|||||.|:..:|...|::|:||||||.|:|||||..||..:|:|.:||||.|
  Rat   260 QNLLISDTGELKLADFGLARAKSVPSHTYSNEVVTLWYRPPDVLLGSTEYSTCLDMWGVGCIFVE 324

  Fly   197 MATRKPLFQGDSEI-DQLFRMFRILKTPTEDIWPGVTSLPDYK-NTFPCWSTNQLT---NQLKNL 256
            |......|.|..:| |||.|:|.:|.||.||.||||.|||.:| ..|..:|:..|.   |:|..:
  Rat   325 MIQGVAAFPGMKDIQDQLERIFLVLGTPNEDTWPGVHSLPHFKPERFTVYSSKSLRQAWNKLSYV 389

  Fly   257 DANGIDLIQKMLIYDPVHRISAKDILEHPYFN 288
            : :..||..|:|...|.:|:||:..|.|.||:
  Rat   390 N-HAEDLASKLLQCSPKNRLSAQAALSHEYFS 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk1NP_476797.1 STKc_CDK1_euk 3..287 CDD:270845 135/288 (47%)
Cdk14NP_001382511.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1010560at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.