DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk1 and CDKL4

DIOPT Version :9

Sequence 1:NP_476797.1 Gene:Cdk1 / 34411 FlyBaseID:FBgn0004106 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001333840.1 Gene:CDKL4 / 344387 HGNCID:19287 Length:379 Species:Homo sapiens


Alignment Length:305 Identity:111/305 - (36%)
Similarity:179/305 - (58%) Gaps:19/305 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEDFEKIEKIGEGTYGVVYKGRNRLTGQIVAMKKIRLESDDEGVPSTAIREISLLKELKHENIVC 65
            ||.:||:.|.|||:||||:|.||:.:||:||:||.....||..|...|:|||.:||:|||.|:|.
Human     1 MEKYEKLAKTGEGSYGVVFKCRNKTSGQVVAVKKFVESEDDPVVKKIALREIRMLKQLKHPNLVN 65

  Fly    66 LEDVLMEENRIYLIFEFLSMDLKKYMDSLPVDKHMESELVRSYLYQITSAILFCHRRRVLHRDLK 130
            |.:|...:.:::|:||:....|...::..|  ..:...:::|.|:|...|:.|||....:|||:|
Human    66 LIEVFRRKRKMHLVFEYCDHTLLNELERNP--NGVADGVIKSVLWQTLQALNFCHIHNCIHRDIK 128

  Fly   131 PQNLLIDKSGLIKVADFGLGRSFGIPVRIYTHEIVTLWYRAPEVLLGSPRYSCPVDIWSIGCIFA 195
            |:|:||.|.|:||:.|||..:.. ||...||..:.|.||||||:|:|..:|...||||:|||:||
Human   129 PENILITKQGIIKICDFGFAQIL-IPGDAYTDYVATRWYRAPELLVGDTQYGSSVDIWAIGCVFA 192

  Fly   196 EMATRKPLFQGDSEIDQLFRMFRILKT---------PTEDIWPGVTSLPDYKNTFPCWSTNQLTN 251
            |:.|.:||:.|.|::|||:.:.|.|..         .:...:.|: |:|:.::      ...|..
Human   193 ELLTGQPLWPGKSDVDQLYLIIRTLGKLIPRHQSIFKSNGFFHGI-SIPEPED------METLEE 250

  Fly   252 QLKNLDANGIDLIQKMLIYDPVHRISAKDILEHPYFNGFQSGLVR 296
            :..::....::.::..|..:|..|::...:||..||:.||...::
Human   251 KFSDVHPVALNFMKGCLKMNPDDRLTCSQLLESSYFDSFQEAQIK 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk1NP_476797.1 STKc_CDK1_euk 3..287 CDD:270845 105/292 (36%)
CDKL4NP_001333840.1 [NKR]KIAxRE 45..51 1/5 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.