DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk1 and CG7236

DIOPT Version :9

Sequence 1:NP_476797.1 Gene:Cdk1 / 34411 FlyBaseID:FBgn0004106 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_608950.3 Gene:CG7236 / 33798 FlyBaseID:FBgn0031730 Length:438 Species:Drosophila melanogaster


Alignment Length:313 Identity:111/313 - (35%)
Similarity:173/313 - (55%) Gaps:44/313 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEDFEKIEKIGEGTYGVVYKGRNRLTGQIVAMKKIRLESDDEGVPSTAIREISLLKELKHENIVC 65
            |:.:||:.::|||:||||||.|:|.||.:||:|:.....||..:...|:|||.|||.|||.|:|.
  Fly    47 MDRYEKLSRLGEGSYGVVYKCRDRETGALVAVKRFVESEDDPAIRKIALREIRLLKNLKHPNLVS 111

  Fly    66 LEDVLMEENRIYLIFEFLSM----DLKKYMDSLPVDKHMESELVRSYLYQITSAILFCHRRRVLH 126
            |.:|...:.|::|:|||..:    :|:::....|      ..|.:...||....:.:||::..||
  Fly   112 LLEVFRRKRRLHLVFEFCELTVLHELERHPQGCP------EHLTKQICYQTLLGVAYCHKQGCLH 170

  Fly   127 RDLKPQNLLIDKSGLIKVADFGLGRSFGIPVRIYTHEIVTLWYRAPEVLLGSPRYSCPVDIWSIG 191
            ||:||:|:|:...|.:|:.|||..|... |...||..:.|.||||||:|:|..:|..|||:|:||
  Fly   171 RDIKPENILLTAQGQVKLCDFGFARMLS-PGENYTDYVATRWYRAPELLVGDTQYGTPVDVWAIG 234

  Fly   192 CIFAEMATRKPLFQGDSEIDQLFRMFRILKTPTEDIWP-------------GVT-----SLPDYK 238
            |:|||:...:.|:.|.|::|||:    :::....|:.|             |:|     :|...:
  Fly   235 CLFAELVRGEALWPGRSDVDQLY----LIRKTLGDLLPRHIQIFGQNEYFKGITLPVPPTLEPLE 295

  Fly   239 NTFPCWS-TNQLTNQLKNLDANGIDLIQKMLIYDPVHRISAKDILEHPYFNGF 290
            :..|..| .|.||          ||.::|.|..||..|.|.:.:.:|.||:.:
  Fly   296 DKMPAKSQQNPLT----------IDFLKKCLDKDPTKRWSCEKLTKHSYFDDY 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk1NP_476797.1 STKc_CDK1_euk 3..287 CDD:270845 108/306 (35%)
CG7236NP_608950.3 STKc_CDKL1_4 48..335 CDD:270837 108/307 (35%)
Pkinase 50..335 CDD:278497 108/305 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442465
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24056
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.