DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk1 and mak

DIOPT Version :9

Sequence 1:NP_476797.1 Gene:Cdk1 / 34411 FlyBaseID:FBgn0004106 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_956240.1 Gene:mak / 335339 ZFINID:ZDB-GENE-030131-7279 Length:633 Species:Danio rerio


Alignment Length:293 Identity:109/293 - (37%)
Similarity:176/293 - (60%) Gaps:14/293 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEDFEKIEKIGEGTYGVVYKGRNRLTGQIVAMKKIRLE--SDDEGVPSTAIREISLLKELKHENI 63
            |..:..::::|:||||.|..|::..:|::||:|:::.:  |.:|   ...:||:..||:|.|.|:
Zfish     1 MNRYTTLKQLGDGTYGSVLMGKSNESGELVAIKRMKRKFYSWEE---CMNLREVKSLKKLNHANV 62

  Fly    64 VCLEDVLMEENRIYLIFEFLSMDLKKYMDSLPVDKHMESELVRSYLYQITSAILFCHRRRVLHRD 128
            |.|::|:.|.:.:|.:||::..:|.:.|.........|:| :|:.::|:.|.:.|.|:....|||
Zfish    63 VKLKEVIRENDHLYFVFEYMKENLYQLMKDRENKMFTENE-IRNIMFQVLSGLAFVHKHGFFHRD 126

  Fly   129 LKPQNLLIDKSGLIKVADFGLGRSFGIPVRI---YTHEIVTLWYRAPEVLLGSPRYSCPVDIWSI 190
            :||:|||.....|:|:|||||.|.    :|.   ||..:.|.|||||||||.||.||.|:|||::
Zfish   127 MKPENLLCMGPELVKIADFGLARE----IRSRPPYTDYVSTRWYRAPEVLLRSPVYSSPIDIWAV 187

  Fly   191 GCIFAEMATRKPLFQGDSEIDQLFRMFRILKTPTEDIWPGVTSLPDYKN-TFPCWSTNQLTNQLK 254
            |||.||:.|.:|||.|:||:|::|::.::|.|..:..||....|....| .||......|...:.
Zfish   188 GCIMAELYTLRPLFPGNSEVDEIFKICQVLGTVKKSDWPEGHQLASAMNFRFPQCVPTPLKTLIP 252

  Fly   255 NLDANGIDLIQKMLIYDPVHRISAKDILEHPYF 287
            |.....:|:::.:|.:||..|.||...|.:|||
Zfish   253 NATNEALDIMRDLLQWDPKKRPSAVKALRYPYF 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk1NP_476797.1 STKc_CDK1_euk 3..287 CDD:270845 106/289 (37%)
makNP_956240.1 STKc_MAK_like 4..285 CDD:270824 106/288 (37%)
S_TKc 4..285 CDD:214567 106/288 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.