DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk1 and Cdk15

DIOPT Version :9

Sequence 1:NP_476797.1 Gene:Cdk1 / 34411 FlyBaseID:FBgn0004106 Length:297 Species:Drosophila melanogaster
Sequence 2:XP_006496111.1 Gene:Cdk15 / 271697 MGIID:3583944 Length:448 Species:Mus musculus


Alignment Length:307 Identity:134/307 - (43%)
Similarity:188/307 - (61%) Gaps:22/307 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IEKIGEGTYGVVYKGRNRLTGQIVAMKKIRLESDDEGVPSTAIREISLLKELKHENIVCLEDVLM 71
            :||:|||:|..||||.:|:.||:||:|.|.:.: :||||.|||||.||||.|||.|||.|.|::.
Mouse   104 LEKLGEGSYAKVYKGISRINGQLVALKVISMNA-EEGVPFTAIREASLLKGLKHANIVLLHDIVH 167

  Fly    72 EENRIYLIFEFLSMDLKKYMDSLPVDKHMESELVRSYLYQITSAILFCHRRRVLHRDLKPQNLLI 136
            .:..:..:||::..||.:||...|...|..:  ||.:::|:...:.:.|.:|||||||||||||:
Mouse   168 TKETLTFVFEYMHTDLAQYMSQHPGGLHPHN--VRLFMFQLLRGLAYIHHQRVLHRDLKPQNLLL 230

  Fly   137 DKSGLIKVADFGLGRSFGIPVRIYTHEIVTLWYRAPEVLLGSPRYSCPVDIWSIGCIFAEMATRK 201
            ...|.:|:|||||.|:..||.:.|:.|:||||||.|:.|||:..||..:|||..||||.||...:
Mouse   231 SHLGELKLADFGLARAKSIPSQTYSSEVVTLWYRPPDALLGATEYSSELDIWGAGCIFIEMFQGQ 295

  Fly   202 PLFQGDSEI-DQLFRMFRILKTPTEDIWPGVTSLPDYK-NTFP---------CW----STNQLTN 251
            |||.|.|.| :||.:::.:|..||||.||||:.||:|. ..||         .|    ::.:..:
Mouse   296 PLFPGVSNILEQLEKIWEVLGVPTEDTWPGVSKLPNYNPEWFPPPKPQSLQIVWDRIAASRETIS 360

  Fly   252 QLKNLDANGI----DLIQKMLIYDPVHRISAKDILEHPYFNGFQSGL 294
            ........|:    ||..:||...|..|:||::.|.|.||:...|.|
Mouse   361 SFHFSRLGGVPEAEDLASQMLKGFPRDRVSAQEALVHDYFSVLPSQL 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk1NP_476797.1 STKc_CDK1_euk 3..287 CDD:270845 130/298 (44%)
Cdk15XP_006496111.1 STKc_PFTAIRE2 100..400 CDD:270852 130/298 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.