DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk1 and srb10

DIOPT Version :9

Sequence 1:NP_476797.1 Gene:Cdk1 / 34411 FlyBaseID:FBgn0004106 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_593389.2 Gene:srb10 / 2541900 PomBaseID:SPAC23H4.17c Length:369 Species:Schizosaccharomyces pombe


Alignment Length:324 Identity:121/324 - (37%)
Similarity:183/324 - (56%) Gaps:42/324 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MED-FEKIEKIGEGTYGVVYK--GRNRLTGQIVAMKKIRLES-------DDEGVPSTAIREISLL 55
            |:| ::.|..|..||||.|||  ..|....::.|:||.:.||       ...||..:||||:.|.
pombe     1 MKDGYKIIGFISSGTYGKVYKAVSSNSNDKRLFAIKKFKAESKQVSSNAQQTGVSQSAIREMMLC 65

  Fly    56 KELKHENIVCLEDVLMEENRIYLIFEFLSMDLKK--YMDSLPVDKHMESELVRSYLYQITSAILF 118
            :|::|||||.|..||:::..|.::||:...||.:  :..|....:.:...:::|.|:||.:.:.:
pombe    66 REIQHENIVSLVQVLLKDGTISMVFEYAEHDLLQIIHFHSRSRTRQIPPSILKSILWQIINGVAY 130

  Fly   119 CHRRRVLHRDLKPQNLLIDKSGLIKVADFGLGRSFGIPV-RIYTHE--IVTLWYRAPEVLLGSPR 180
            .|...::||||||.|::|..:|.:|:.|.||||....|: ..|:.:  :||:||||||:|||:..
pombe   131 LHENWIMHRDLKPANIMITATGKVKIGDLGLGRLIRDPILPFYSSDRVVVTIWYRAPELLLGAHD 195

  Fly   181 YSCPVDIWSIGCIFAEMATRKPLFQGDS-----------EIDQLFRMFRILKTPTEDIWPGVTSL 234
            |:..:|:|:||||:.||....|||:||.           :..|:.|:..:|.||||:.|||:.:.
pombe   196 YTPAIDVWAIGCIYGEMLALSPLFKGDEIKMEDKKVVPFQSTQMLRIMELLGTPTEERWPGLKNY 260

  Fly   235 PDY-----------KNTFPCWSTNQLTNQLKNLDANGIDLIQKMLIYDPVHRISAKDILEHPYF 287
            |:|           .|..|.|     ...:||.|..|:||:.|||.|||..||:||..|||.:|
pombe   261 PEYYQLSSFEVRYWNNLLPQW-----YQTVKNRDPQGLDLLMKMLQYDPKSRITAKQALEHVFF 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk1NP_476797.1 STKc_CDK1_euk 3..287 CDD:270845 119/320 (37%)
srb10NP_593389.2 PTZ00024 1..324 CDD:240233 121/324 (37%)
STKc_CDK8_like 4..319 CDD:270834 118/319 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.