DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk1 and ppk23

DIOPT Version :9

Sequence 1:NP_476797.1 Gene:Cdk1 / 34411 FlyBaseID:FBgn0004106 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_595739.1 Gene:ppk23 / 2540799 PomBaseID:SPBC18H10.15 Length:398 Species:Schizosaccharomyces pombe


Alignment Length:294 Identity:137/294 - (46%)
Similarity:196/294 - (66%) Gaps:12/294 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEDFEKIEKIGEGTYGVVYKGRNRLTGQIVAMKKIRLESDDEGVPSTAIREISLLKELKHENIVC 65
            ::|:|.:|||.||:||:||:|.::.|..:||:|||:.:.:..|.|.|::|||..|..::|:|||.
pombe    71 IDDYEILEKIEEGSYGIVYRGLDKSTNTLVALKKIKFDPNGIGFPITSLREIESLSSIRHDNIVE 135

  Fly    66 LEDVLMEEN--RIYLIFEFLSMDLKKYMDSLPVDKHMESELVRSYLYQITSAILFCHRRRVLHRD 128
            ||.|::.::  .:||:.||:..|||..:|::|.| .::|| |::.:.|:.:|..|.|....||||
pombe   136 LEKVVVGKDLKDVYLVMEFMEHDLKTLLDNMPED-FLQSE-VKTLMLQLLAATAFMHHHWYLHRD 198

  Fly   129 LKPQNLLIDKSGLIKVADFGLGRSFGIPVRIYTHEIVTLWYRAPEVLLGSPRYSCPVDIWSIGCI 193
            |||.|||::.:|.||:|||||.|....|....|..:|||||||||:|||:|.|...:|:||||||
pombe   199 LKPSNLLMNNTGEIKLADFGLARPVSEPKSSLTRLVVTLWYRAPELLLGAPSYGKEIDMWSIGCI 263

  Fly   194 FAEMATRKPLFQGDSEIDQLFRMFRILKTPTEDIWPGVTSLPDYKN-----TFPCWSTNQLTNQL 253
            ||||.||.|||.|.||:|||:::|.:|..||.:.||....|| |.|     |.|..|  ::...:
pombe   264 FAEMITRTPLFSGKSELDQLYKIFNLLGYPTREEWPQYFLLP-YANKIKHPTVPTHS--KIRTSI 325

  Fly   254 KNLDANGIDLIQKMLIYDPVHRISAKDILEHPYF 287
            .||..|..||:.::|..:|..|||||:.||||||
pombe   326 PNLTGNAYDLLNRLLSLNPAKRISAKEALEHPYF 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk1NP_476797.1 STKc_CDK1_euk 3..287 CDD:270845 135/290 (47%)
ppk23NP_595739.1 STKc_CDC2L1 68..359 CDD:173741 135/292 (46%)
PLN00009 71..361 CDD:177649 137/294 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.