DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk1 and cdc2

DIOPT Version :9

Sequence 1:NP_476797.1 Gene:Cdk1 / 34411 FlyBaseID:FBgn0004106 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001342995.1 Gene:cdc2 / 2539869 PomBaseID:SPBC11B10.09 Length:297 Species:Schizosaccharomyces pombe


Alignment Length:296 Identity:181/296 - (61%)
Similarity:227/296 - (76%) Gaps:6/296 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEDFEKIEKIGEGTYGVVYKGRNRLTGQIVAMKKIRLESDDEGVPSTAIREISLLKELKHE---- 61
            ||:::|:|||||||||||||.|::|:|:||||||||||.:.||||||||||||||||:..|    
pombe     1 MENYQKVEKIGEGTYGVVYKARHKLSGRIVAMKKIRLEDESEGVPSTAIREISLLKEVNDENNRS 65

  Fly    62 NIVCLEDVLMEENRIYLIFEFLSMDLKKYMDSLPVD--KHMESELVRSYLYQITSAILFCHRRRV 124
            |.|.|.|:|..|:::||:||||.||||||||.:...  ..::..||:.:.||:.:.:.|||.||:
pombe    66 NCVRLLDILHAESKLYLVFEFLDMDLKKYMDRISETGATSLDPRLVQKFTYQLVNGVNFCHSRRI 130

  Fly   125 LHRDLKPQNLLIDKSGLIKVADFGLGRSFGIPVRIYTHEIVTLWYRAPEVLLGSPRYSCPVDIWS 189
            :|||||||||||||.|.:|:|||||.||||:|:|.|||||||||||||||||||..||..|||||
pombe   131 IHRDLKPQNLLIDKEGNLKLADFGLARSFGVPLRNYTHEIVTLWYRAPEVLLGSRHYSTGVDIWS 195

  Fly   190 IGCIFAEMATRKPLFQGDSEIDQLFRMFRILKTPTEDIWPGVTSLPDYKNTFPCWSTNQLTNQLK 254
            :|||||||..|.|||.||||||::|::|::|.||.|::|||||.|.|||:|||.|....|...:.
pombe   196 VGCIFAEMIRRSPLFPGDSEIDEIFKIFQVLGTPNEEVWPGVTLLQDYKSTFPRWKRMDLHKVVP 260

  Fly   255 NLDANGIDLIQKMLIYDPVHRISAKDILEHPYFNGF 290
            |.:.:.|:|:..||:|||.||||||..|:..|...|
pombe   261 NGEEDAIELLSAMLVYDPAHRISAKRALQQNYLRDF 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk1NP_476797.1 STKc_CDK1_euk 3..287 CDD:270845 177/289 (61%)
cdc2NP_001342995.1 STKc_CDK1_CdkB_like 4..293 CDD:270829 177/288 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 367 1.000 Domainoid score I143
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 374 1.000 Inparanoid score I435
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000411
OrthoInspector 1 1.000 - - oto100721
orthoMCL 1 0.900 - - OOG6_100334
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R185
SonicParanoid 1 1.000 - - X960
TreeFam 1 0.960 - -
109.750

Return to query results.
Submit another query.