DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk1 and cdk-2

DIOPT Version :9

Sequence 1:NP_476797.1 Gene:Cdk1 / 34411 FlyBaseID:FBgn0004106 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001021537.2 Gene:cdk-2 / 171911 WormBaseID:WBGene00019362 Length:338 Species:Caenorhabditis elegans


Alignment Length:301 Identity:146/301 - (48%)
Similarity:208/301 - (69%) Gaps:14/301 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FEKIEKIGEGTYGVVYKGRNRLTGQIVAMKKIRLESDDEGVPSTAIREISLLKELKHENIVCLED 68
            |..:.:|||||||||:|..:.......|:|.||.:.|:||:|||.:||||.:|:|:|:|||.|.|
 Worm    15 FCSLRRIGEGTYGVVFKAIHVRDNVKCALKMIRTDRDEEGIPSTCLREISCIKDLQHDNIVTLFD 79

  Fly    69 VLMEENRIYLIFEFLSMDLKKYMDSL-PVDKHMESELVRSYLYQITSAILFCHRRRVLHRDLKPQ 132
            ::...:::|::|||:..|||..::.| |.:..:....|:|:::|:.||:.:||.||::|||||||
 Worm    80 IIYANSKLYMVFEFIDRDLKNLLEMLEPTNSVLPPNYVKSFMWQLLSALSYCHLRRIVHRDLKPQ 144

  Fly   133 NLLIDKSGLIKVADFGLGRSFGIPVRIYTHEIVTLWYRAPEVLLGSPRYSCPVDIWSIGCIFAEM 197
            |:|:..||:||:|||||.|:|..|.|.||||:||||||.||:||||.|||..:|:||:||||:|:
 Worm   145 NILVSDSGVIKIADFGLARNFSFPSRNYTHEVVTLWYRPPEILLGSQRYSTSLDMWSLGCIFSEI 209

  Fly   198 ATRKPLFQGDSEIDQLFRMFRILKTPTEDIWPGVTSLPDYKNTFPCWSTNQLTNQLKNLD----- 257
            |:.||||.|:.||.|||::|.|:.||....||||.|.|.||..||.|..|     ||.|:     
 Worm   210 ASNKPLFPGECEISQLFKIFEIVGTPNIKSWPGVDSFPHYKAVFPQWPVN-----LKKLEETSCL 269

  Fly   258 -ANGIDLIQKMLIYDPVHRISAKDILEHPYFNGFQSGLVRN 297
             .||:|:::::|.|.|..|::||..|.|.||  .|:|..:|
 Worm   270 TGNGLDVLREILRYPPERRLTAKGALSHRYF--LQNGFTQN 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk1NP_476797.1 STKc_CDK1_euk 3..287 CDD:270845 141/289 (49%)
cdk-2NP_001021537.2 STKc_CDK_like 15..300 CDD:270823 141/289 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1010560at2759
OrthoFinder 1 1.000 - - FOG0000411
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.