DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk1 and CDK6

DIOPT Version :9

Sequence 1:NP_476797.1 Gene:Cdk1 / 34411 FlyBaseID:FBgn0004106 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001138778.1 Gene:CDK6 / 1021 HGNCID:1777 Length:326 Species:Homo sapiens


Alignment Length:299 Identity:124/299 - (41%)
Similarity:191/299 - (63%) Gaps:14/299 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EDFEKIEKIGEGTYGVVYKGRN-RLTGQIVAMKKIRLESDDEGVPSTAIREISLLKEL---KHEN 62
            :.:|.:.:||||.||.|:|.|: :..|:.||:|::|:::.:||:|.:.|||:::|:.|   :|.|
Human    11 QQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPN 75

  Fly    63 IVCLEDVLM-----EENRIYLIFEFLSMDLKKYMDSLPVDKHMESELVRSYLYQITSAILFCHRR 122
            :|.|.||..     .|.::.|:||.:..||..|:|.:| :..:.:|.::..::|:...:.|.|..
Human    76 VVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVP-EPGVPTETIKDMMFQLLRGLDFLHSH 139

  Fly   123 RVLHRDLKPQNLLIDKSGLIKVADFGLGRSFGIPVRIYTHEIVTLWYRAPEVLLGSPRYSCPVDI 187
            ||:||||||||:|:..||.||:|||||.|.:...:.: |..:||||||||||||.| .|:.|||:
Human   140 RVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMAL-TSVVVTLWYRAPEVLLQS-SYATPVDL 202

  Fly   188 WSIGCIFAEMATRKPLFQGDSEIDQLFRMFRILKTPTEDIWPGVTSLPDYKNTFPCWSTNQLTNQ 252
            ||:|||||||..|||||:|.|::|||.::..::..|.|:.||...:||  :..|...|...:...
Human   203 WSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALP--RQAFHSKSAQPIEKF 265

  Fly   253 LKNLDANGIDLIQKMLIYDPVHRISAKDILEHPYFNGFQ 291
            :.::|..|.||:.|.|.::|..||||...|.||||...:
Human   266 VTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLE 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk1NP_476797.1 STKc_CDK1_euk 3..287 CDD:270845 122/292 (42%)
CDK6NP_001138778.1 STKc_CDK6 11..300 CDD:270846 122/293 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.