DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdk1 and CDK3

DIOPT Version :9

Sequence 1:NP_476797.1 Gene:Cdk1 / 34411 FlyBaseID:FBgn0004106 Length:297 Species:Drosophila melanogaster
Sequence 2:NP_001249.1 Gene:CDK3 / 1018 HGNCID:1772 Length:305 Species:Homo sapiens


Alignment Length:288 Identity:189/288 - (65%)
Similarity:229/288 - (79%) Gaps:1/288 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEDFEKIEKIGEGTYGVVYKGRNRLTGQIVAMKKIRLESDDEGVPSTAIREISLLKELKHENIVC 65
            |:.|:|:|||||||||||||.:||.|||:||:|||||:.:.|||||||||||||||||||.|||.
Human     1 MDMFQKVEKIGEGTYGVVYKAKNRETGQLVALKKIRLDLEMEGVPSTAIREISLLKELKHPNIVR 65

  Fly    66 LEDVLMEENRIYLIFEFLSMDLKKYMDSLPVDKHMESELVRSYLYQITSAILFCHRRRVLHRDLK 130
            |.||:..|.::||:|||||.||||||||.| ...:...|::|||:|:...:.|||..||:|||||
Human    66 LLDVVHNERKLYLVFEFLSQDLKKYMDSTP-GSELPLHLIKSYLFQLLQGVSFCHSHRVIHRDLK 129

  Fly   131 PQNLLIDKSGLIKVADFGLGRSFGIPVRIYTHEIVTLWYRAPEVLLGSPRYSCPVDIWSIGCIFA 195
            ||||||::.|.||:|||||.|:||:|:|.||||:|||||||||:||||..|:..|||||||||||
Human   130 PQNLLINELGAIKLADFGLARAFGVPLRTYTHEVVTLWYRAPEILLGSKFYTTAVDIWSIGCIFA 194

  Fly   196 EMATRKPLFQGDSEIDQLFRMFRILKTPTEDIWPGVTSLPDYKNTFPCWSTNQLTNQLKNLDANG 260
            ||.|||.||.||||||||||:||:|.||:||.|||||.|||||.:||.|:...|...:.||:..|
Human   195 EMVTRKALFPGDSEIDQLFRIFRMLGTPSEDTWPGVTQLPDYKGSFPKWTRKGLEEIVPNLEPEG 259

  Fly   261 IDLIQKMLIYDPVHRISAKDILEHPYFN 288
            .||:.::|.|||..||:||..|.||||:
Human   260 RDLLMQLLQYDPSQRITAKTALAHPYFS 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdk1NP_476797.1 STKc_CDK1_euk 3..287 CDD:270845 186/283 (66%)
CDK3NP_001249.1 PLN00009 1..293 CDD:177649 189/288 (66%)
STKc_CDK2_3 3..286 CDD:270844 186/283 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0594
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1010560at2759
OrthoFinder 1 1.000 - - FOG0000411
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100334
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X960
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.