| Sequence 1: | NP_723576.1 | Gene: | CG5096 / 34410 | FlyBaseID: | FBgn0032235 | Length: | 491 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_110483.2 | Gene: | Lrrn3 / 81514 | RGDID: | 71066 | Length: | 707 | Species: | Rattus norvegicus |
| Alignment Length: | 374 | Identity: | 99/374 - (26%) |
|---|---|---|---|
| Similarity: | 158/374 - (42%) | Gaps: | 57/374 - (15%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 43 DSKL-CKK-CNC-----------YIDTNLLDCSE----KLQDWLSAEDW------------EDLT 78
Fly 79 NGNVVFKTINLEHNNLTSVPILPKYDVENL---YLANNQIDSISVGAFQNLTELVTLDLSHNRLT 140
Fly 141 SKVLVPDVFKGPFTVQDFESLENLKTLNLGYNDLHSLDADLFEHIPHIEELVLCSNSFHVIDQLS 205
Fly 206 ETAISGLQSLKILDVSYMEIDDLPDTILHGPRDLEIFIAAGNLFNQLPK-ALKYATNLTSLVLNE 269
Fly 270 NPIENLIGDNVFPPLTKLTHLSMTFMSKLYKIGPGAFSELQSLTELILSDNKLLNEIDEEALSKN 334
Fly 335 VTGGQYLDYPPLEKVYLNNCNVSTLPKELLVRWDKLKALDLRFNPWNCD 383 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG5096 | NP_723576.1 | LRR_RI | 69..378 | CDD:238064 | 87/324 (27%) |
| leucine-rich repeat | 85..104 | CDD:275380 | 6/18 (33%) | ||
| LRR_8 | 105..174 | CDD:290566 | 19/71 (27%) | ||
| leucine-rich repeat | 105..128 | CDD:275380 | 5/25 (20%) | ||
| leucine-rich repeat | 129..163 | CDD:275380 | 9/33 (27%) | ||
| LRR_8 | 163..222 | CDD:290566 | 18/58 (31%) | ||
| leucine-rich repeat | 164..187 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 188..214 | CDD:275380 | 6/25 (24%) | ||
| leucine-rich repeat | 215..238 | CDD:275380 | 6/22 (27%) | ||
| leucine-rich repeat | 239..261 | CDD:275380 | 8/22 (36%) | ||
| LRR_8 | 260..322 | CDD:290566 | 20/61 (33%) | ||
| leucine-rich repeat | 262..286 | CDD:275380 | 10/23 (43%) | ||
| leucine-rich repeat | 287..311 | CDD:275380 | 7/23 (30%) | ||
| leucine-rich repeat | 346..369 | CDD:275380 | 6/22 (27%) | ||
| leucine-rich repeat | 370..388 | CDD:275380 | 6/14 (43%) | ||
| Lrrn3 | NP_110483.2 | LRRNT | 28..72 | CDD:214470 | 8/43 (19%) |
| LRR 1 | 70..91 | 2/20 (10%) | |||
| LRR | <72..355 | CDD:227223 | 83/306 (27%) | ||
| leucine-rich repeat | 72..93 | CDD:275380 | 2/20 (10%) | ||
| LRR 2 | 93..114 | 6/20 (30%) | |||
| leucine-rich repeat | 94..117 | CDD:275380 | 6/22 (27%) | ||
| LRR 3 | 117..138 | 4/20 (20%) | |||
| leucine-rich repeat | 118..141 | CDD:275380 | 5/22 (23%) | ||
| LRR 4 | 141..162 | 7/22 (32%) | |||
| leucine-rich repeat | 142..165 | CDD:275380 | 9/33 (27%) | ||
| LRR 5 | 165..186 | 7/20 (35%) | |||
| leucine-rich repeat | 166..189 | CDD:275380 | 7/22 (32%) | ||
| LRR 6 | 189..210 | 5/20 (25%) | |||
| leucine-rich repeat | 190..213 | CDD:275380 | 5/22 (23%) | ||
| LRR 7 | 213..234 | 7/23 (30%) | |||
| leucine-rich repeat | 214..237 | CDD:275380 | 8/25 (32%) | ||
| LRR 8 | 237..258 | 7/20 (35%) | |||
| leucine-rich repeat | 238..261 | CDD:275380 | 8/22 (36%) | ||
| LRR 9 | 261..282 | 11/21 (52%) | |||
| leucine-rich repeat | 262..285 | CDD:275380 | 10/23 (43%) | ||
| LRR 10 | 285..304 | 5/18 (28%) | |||
| leucine-rich repeat | 286..310 | CDD:275380 | 7/23 (30%) | ||
| LRR 11 | 310..332 | 5/30 (17%) | |||
| leucine-rich repeat | 311..333 | CDD:275380 | 5/30 (17%) | ||
| LRR 12 | 335..358 | 6/22 (27%) | |||
| leucine-rich repeat | 336..359 | CDD:275378 | 6/22 (27%) | ||
| PCC | 341..>405 | CDD:188093 | 10/33 (30%) | ||
| leucine-rich repeat | 360..372 | CDD:275378 | 4/11 (36%) | ||
| Ig | 440..513 | CDD:416386 | |||
| Ig strand B | 440..447 | CDD:409353 | |||
| Ig strand C | 453..458 | CDD:409353 | |||
| Ig strand C' | 461..464 | CDD:409353 | |||
| Ig strand D | 470..474 | CDD:409353 | |||
| Ig strand E | 479..483 | CDD:409353 | |||
| Ig strand F | 493..500 | CDD:409353 | |||
| Ig strand G | 503..513 | CDD:409353 | |||
| fn3 | 526..593 | CDD:394996 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||