DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5096 and SLIT3

DIOPT Version :9

Sequence 1:NP_723576.1 Gene:CG5096 / 34410 FlyBaseID:FBgn0032235 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001258875.2 Gene:SLIT3 / 6586 HGNCID:11087 Length:1530 Species:Homo sapiens


Alignment Length:466 Identity:101/466 - (21%)
Similarity:179/466 - (38%) Gaps:134/466 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 CNCYIDTNLLDCSEKLQDWLSAEDWEDLTNGNVVFKTINLEHNNLTSVP--ILPKY-DVENLYLA 111
            |.|  ..|::||..|....:.|    :|..|.|   .|.||.|::.::|  ...:| .::.:.::
Human   284 CTC--SNNIVDCRGKGLMEIPA----NLPEGIV---EIRLEQNSIKAIPAGAFTQYKKLKRIDIS 339

  Fly   112 NNQIDSISVGAFQNLTELVTLDLSHNRLTSKVLVPDVFKGPFTVQ---------------DFESL 161
            .|||..|:..|||.|..|.:|.|..|::|.  :|..:|.|..::|               .|:.|
Human   340 KNQISDIAPDAFQGLKSLTSLVLYGNKITE--IVKGLFDGLVSLQLLLLNANKINCLRVNTFQDL 402

  Fly   162 ENLKTLNLGYNDLHSLDADLFEHIPHIEELVLCSNSFHVID------------------------ 202
            :||..|:|..|.|.::...||..:..|:.|.|..|.| |.|                        
Human   403 QNLNLLSLYDNKLQTISKGLFAPLQSIQTLHLAQNPF-VCDCHLKWLADYLQDNPIETSGARCSS 466

  Fly   203 --QLSETAISGLQSLK--------------------------------ILDVSYMEIDDLPDTIL 233
              :|:...||.::|.|                                |:|.|..::..:|    
Human   467 PRRLANKRISQIKSKKFRCSGSEDYRSRFSSECFMDLVCPEKCRCEGTIVDCSNQKLVRIP---- 527

  Fly   234 HGPRDLEIFIAAGNLFNQLPKALKYATNLTSLVLNENPIENLIGDNVFPPLTKLTHLSMTFMSKL 298
                            :.||   :|.|:|.   ||:|.:..|....:|..|..|..:::: .:|:
Human   528 ----------------SHLP---EYVTDLR---LNDNEVSVLEATGIFKKLPNLRKINLS-NNKI 569

  Fly   299 YKIGPGAFSELQSLTELILSDNKL----------LNEIDEEALSKNVTG----GQYLDYPPLEKV 349
            .::..|||....|:.||:|:.|:|          |:.:....|..|:.|    ..:.....:..:
Human   570 KEVREGAFDGAASVQELMLTGNQLETVHGRVFRGLSGLKTLMLRSNLIGCVSNDTFAGLSSVRLL 634

  Fly   350 YLNNCNVSTLPKELLVRWDKLKALDLRFNPWNCDESNDFLINVLIDRINKTTPVLAKDVKCGGPN 414
            .|.:..::|:..........|..::|..||:||:....:|...|..|     .:::.:.:|..|.
Human   635 SLYDNRITTITPGAFTTLVSLSTINLLSNPFNCNCHLAWLGKWLRKR-----RIVSGNPRCQKPF 694

  Fly   415 KLNDVTLLRVA 425
            .|.::.:..||
Human   695 FLKEIPIQDVA 705

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5096NP_723576.1 LRR_RI 69..378 CDD:238064 83/398 (21%)
leucine-rich repeat 85..104 CDD:275380 6/21 (29%)
LRR_8 105..174 CDD:290566 24/83 (29%)
leucine-rich repeat 105..128 CDD:275380 8/22 (36%)
leucine-rich repeat 129..163 CDD:275380 11/48 (23%)
LRR_8 163..222 CDD:290566 22/116 (19%)
leucine-rich repeat 164..187 CDD:275380 7/22 (32%)
leucine-rich repeat 188..214 CDD:275380 10/51 (20%)
leucine-rich repeat 215..238 CDD:275380 5/54 (9%)
leucine-rich repeat 239..261 CDD:275380 3/21 (14%)
LRR_8 260..322 CDD:290566 18/61 (30%)
leucine-rich repeat 262..286 CDD:275380 7/23 (30%)
leucine-rich repeat 287..311 CDD:275380 5/23 (22%)
leucine-rich repeat 346..369 CDD:275380 2/22 (9%)
leucine-rich repeat 370..388 CDD:275380 6/17 (35%)
SLIT3NP_001258875.2 LRRNT 33..64 CDD:214470
LRR <62..>220 CDD:227223
LRR 1 62..83
leucine-rich repeat 64..86 CDD:275380
LRR 2 86..107
leucine-rich repeat 87..110 CDD:275380
internalin_A 107..>478 CDD:380193 53/205 (26%)
LRR 3 110..131
leucine-rich repeat 111..134 CDD:275380
LRR 4 134..155
leucine-rich repeat 135..158 CDD:275380
LRR 5 158..179
leucine-rich repeat 159..182 CDD:275380
LRR 6 182..203
leucine-rich repeat 183..206 CDD:275380
leucine-rich repeat 207..308 CDD:275380 8/29 (28%)
LRR 7 308..329 7/23 (30%)
leucine-rich repeat 309..332 CDD:275380 7/25 (28%)
LRR_8 311..367 CDD:338972 18/55 (33%)
LRR 8 332..353 6/20 (30%)
leucine-rich repeat 333..356 CDD:275380 8/22 (36%)
LRR 9 356..377 7/22 (32%)
leucine-rich repeat 357..377 CDD:275380 7/21 (33%)
LRR 10 380..401 2/20 (10%)
leucine-rich repeat 381..404 CDD:275380 3/22 (14%)
LRR 11 404..425 8/20 (40%)
leucine-rich repeat 405..428 CDD:275380 7/22 (32%)
LRRNT 505..535 CDD:214470 7/52 (13%)
LRR 12 533..554 7/23 (30%)
LRR_8 534..593 CDD:338972 18/62 (29%)
leucine-rich repeat 534..558 CDD:275380 8/26 (31%)
LRR 13 558..579 5/21 (24%)
leucine-rich repeat 559..582 CDD:275380 5/23 (22%)
LRR_8 582..641 CDD:338972 11/58 (19%)
LRR 14 582..603 6/20 (30%)
leucine-rich repeat 583..606 CDD:275380 6/22 (27%)
LRR 15 606..627 3/20 (15%)
leucine-rich repeat 607..630 CDD:275380 3/22 (14%)
LRR 16 630..651 2/20 (10%)
leucine-rich repeat 631..654 CDD:275380 2/22 (9%)
PCC 636..>714 CDD:188093 16/75 (21%)
leucine-rich repeat 655..745 CDD:275380 14/56 (25%)
LRRNT 725..756 CDD:214470
LRR <743..>869 CDD:227223
leucine-rich repeat 746..776 CDD:275380
LRR 17 753..775
LRR_8 776..835 CDD:338972
LRR 18 776..797
leucine-rich repeat 777..800 CDD:275380
LRR 19 800..821
leucine-rich repeat 801..824 CDD:275380
LRR 20 824..845
leucine-rich repeat 825..846 CDD:275380
PCC 830..>912 CDD:188093
EGF_CA 963..1001 CDD:238011
EGF_CA 1005..1038 CDD:238011
EGF_CA 1042..1079 CDD:238011
EGF_CA 1081..1117 CDD:238011
EGF 1130..1160 CDD:333761
LamG 1188..1321 CDD:214598
EGF 1379..1407 CDD:333761
GHB_like <1473..1528 CDD:389804
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.