DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5096 and SLIT1

DIOPT Version :9

Sequence 1:NP_723576.1 Gene:CG5096 / 34410 FlyBaseID:FBgn0032235 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_003052.2 Gene:SLIT1 / 6585 HGNCID:11085 Length:1534 Species:Homo sapiens


Alignment Length:466 Identity:112/466 - (24%)
Similarity:175/466 - (37%) Gaps:128/466 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 CNCYIDTNLLDCSEKLQDWLSAEDWEDLTNGNVVFKTINLEHNNLTSVP---ILPKYDVENLYLA 111
            |.|  ...::||..|....:.|...|.:|.       |.||.|.:.|:|   ..|...:..:.|:
Human   286 CTC--SNGIVDCRGKGLTAIPANLPETMTE-------IRLELNGIKSIPPGAFSPYRKLRRIDLS 341

  Fly   112 NNQIDSISVGAFQNLTELVTLDLSHNRLTSKVLVPDVFKGPFTVQ---------------DFESL 161
            ||||..|:..|||.|..|.:|.|..|::|.  |...||.|.:|:|               .|:.|
Human   342 NNQIAEIAPDAFQGLRSLNSLVLYGNKITD--LPRGVFGGLYTLQLLLLNANKINCIRPDAFQDL 404

  Fly   162 ENLKTLNLGYNDLHSLDADLFEHIPHIEELVLCSNSFHVID------------------------ 202
            :||..|:|..|.:.||....|..:..|:.|.|..|.| :.|                        
Human   405 QNLSLLSLYDNKIQSLAKGTFTSLRAIQTLHLAQNPF-ICDCNLKWLADFLRTNPIETSGARCAS 468

  Fly   203 --QLSETAISGLQSLKILDVSYMEIDDLPDTILHGPRDLEI-------------------FIAAG 246
              :|:...|..::|.| ...|..|...:|     |..|.::                   .:...
Human   469 PRRLANKRIGQIKSKK-FRCSAKEQYFIP-----GTEDYQLNSECNSDVVCPHKCRCEANVVECS 527

  Fly   247 NL-FNQLPKALKYATNLTSLVLNENPIENLIGDNVFPPLTKLTHLSMTFMS--KLYKIGPGAFSE 308
            :| ..::|:.:..:|  ..|.||.|.|..|....:|   .|||||....:|  |:.:|..|||..
Human   528 SLKLTKIPERIPQST--AELRLNNNEISILEATGMF---KKLTHLKKINLSNNKVSEIEDGAFEG 587

  Fly   309 LQSLTELILSDNKLLNEIDEEALSKNVTGGQYLDYPPLEKVYLNNCNVSTLPKE---------LL 364
            ..|::||.|:.|:|          :::..|.:.....|..:.|.|..:|.:..:         ||
Human   588 AASVSELHLTANQL----------ESIRSGMFRGLDGLRTLMLRNNRISCIHNDSFTGLRNVRLL 642

  Fly   365 VRWD---------------KLKALDLRFNPWNCDESNDFLINVLIDRINKTTPVLAKDVKCGGPN 414
            ..:|               .|..|:|..||:||:....:|...|..|     .::..:.:|..|:
Human   643 SLYDNQITTVSPGAFDTLQSLSTLNLLANPFNCNCQLAWLGGWLRKR-----KIVTGNPRCQNPD 702

  Fly   415 KLNDVTLLRVA 425
            .|..:.|..||
Human   703 FLRQIPLQDVA 713

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5096NP_723576.1 LRR_RI 69..378 CDD:238064 94/398 (24%)
leucine-rich repeat 85..104 CDD:275380 7/21 (33%)
LRR_8 105..174 CDD:290566 28/83 (34%)
leucine-rich repeat 105..128 CDD:275380 10/22 (45%)
leucine-rich repeat 129..163 CDD:275380 13/48 (27%)
LRR_8 163..222 CDD:290566 18/84 (21%)
leucine-rich repeat 164..187 CDD:275380 7/22 (32%)
leucine-rich repeat 188..214 CDD:275380 8/51 (16%)
leucine-rich repeat 215..238 CDD:275380 5/22 (23%)
leucine-rich repeat 239..261 CDD:275380 2/41 (5%)
LRR_8 260..322 CDD:290566 24/63 (38%)
leucine-rich repeat 262..286 CDD:275380 7/23 (30%)
leucine-rich repeat 287..311 CDD:275380 10/25 (40%)
leucine-rich repeat 346..369 CDD:275380 7/46 (15%)
leucine-rich repeat 370..388 CDD:275380 7/17 (41%)
SLIT1NP_003052.2 LRRNT 33..64 CDD:214470
leucine-rich repeat 43..62 CDD:275380
LRR_8 61..121 CDD:290566
LRR 1 62..83
leucine-rich repeat 63..86 CDD:275380
LRR_4 64..101 CDD:289563
LRR 2 86..107
LRR_RI <87..220 CDD:238064
leucine-rich repeat 87..110 CDD:275380
LRR_8 109..169 CDD:290566
LRR 3 110..131
leucine-rich repeat 111..134 CDD:275380
LRR 4 134..155
leucine-rich repeat 135..158 CDD:275380
LRR 5 158..179
LRR_8 159..217 CDD:290566
leucine-rich repeat 159..182 CDD:275380
LRR 6 182..203
leucine-rich repeat 183..206 CDD:275380
leucine-rich repeat 207..334 CDD:275380 15/56 (27%)
TPKR_C2 219..264 CDD:301599
LRRNT 282..313 CDD:214470 7/28 (25%)
LRR 7 310..331 7/27 (26%)
LRR_8 312..369 CDD:290566 22/63 (35%)
LRR_4 334..373 CDD:289563 15/40 (38%)
LRR 8 334..355 8/20 (40%)
leucine-rich repeat 335..358 CDD:275380 10/22 (45%)
LRR 9 358..379 8/22 (36%)
leucine-rich repeat 359..379 CDD:275380 8/21 (38%)
LRR 10 382..403 3/20 (15%)
leucine-rich repeat 383..406 CDD:275380 3/22 (14%)
LRR_8 389..441 CDD:290566 14/51 (27%)
LRR 11 406..427 8/20 (40%)
leucine-rich repeat 407..428 CDD:275380 7/20 (35%)
leucine-rich repeat 431..528 CDD:275380 15/103 (15%)
TPKR_C2 439..>469 CDD:301599 3/30 (10%)
LRRNT 513..542 CDD:214470 2/28 (7%)
leucine-rich repeat 529..566 CDD:275380 12/41 (29%)
LRR 12 541..562 8/25 (32%)
LRR_RI <544..627 CDD:238064 28/95 (29%)
LRR_8 544..601 CDD:290566 23/59 (39%)
LRR 13 566..587 8/20 (40%)
leucine-rich repeat 567..590 CDD:275380 7/22 (32%)
LRR_8 590..649 CDD:290566 14/68 (21%)
LRR 14 590..611 7/30 (23%)
leucine-rich repeat 591..614 CDD:275380 6/32 (19%)
LRR 15 614..635 4/20 (20%)
LRR_4 615..654 CDD:289563 7/38 (18%)
leucine-rich repeat 615..638 CDD:275380 4/22 (18%)
LRR 16 638..659 3/20 (15%)
leucine-rich repeat 639..660 CDD:275380 3/20 (15%)
leucine-rich repeat 663..762 CDD:275380 16/56 (29%)
LRRCT 671..719 CDD:214507 13/48 (27%)
LRRNT 733..765 CDD:214470
LRR_8 761..820 CDD:290566
LRR 17 762..783
leucine-rich repeat 763..785 CDD:275380
LRR 18 785..806
LRR_4 786..827 CDD:289563
leucine-rich repeat 786..809 CDD:275380
LRR 19 809..830
leucine-rich repeat 810..830 CDD:275380
LRR 20 833..854
leucine-rich repeat 834..857 CDD:275380
LRRCT 866..915 CDD:214507
EGF_CA 927..962 CDD:238011
EGF_CA 966..1002 CDD:238011
EGF_CA 1005..1041 CDD:238011
EGF_CA 1044..1080 CDD:238011
EGF_CA 1085..1119 CDD:238011
EGF_CA <1136..1163 CDD:238011
LamG 1189..1322 CDD:214598
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.