DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5096 and lrrc4cb

DIOPT Version :9

Sequence 1:NP_723576.1 Gene:CG5096 / 34410 FlyBaseID:FBgn0032235 Length:491 Species:Drosophila melanogaster
Sequence 2:XP_005166545.1 Gene:lrrc4cb / 564462 ZFINID:ZDB-GENE-080327-5 Length:631 Species:Danio rerio


Alignment Length:388 Identity:89/388 - (22%)
Similarity:150/388 - (38%) Gaps:104/388 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 VIDSKLCKK-CNCYIDTNLLDCSEKLQDWLSAEDWEDLTNGNVVFKTINLEHNNLTSVPILPKYD 104
            ::.::.|.. |:|....:.:.|:.:     ..:|..|..:.|.  :.:||:.|.:..:    |.|
Zfish    42 LVRAQTCPSVCSCSNQFSKVICTRR-----GLKDVPDGVSTNT--RYLNLQDNQIQVI----KVD 95

  Fly   105 -------VENLYLANNQIDSISVGAFQNLTELVTLDLSHNRLTSKVLVPDVFKGPFTVQDFESLE 162
                   :|.|.|:.|.|.:|.:|||..||.|.||:|..||||:   :|:        ..||.|.
Zfish    96 SFKHLRHLEILQLSRNHIRNIEIGAFNGLTSLNTLELFDNRLTT---IPN--------GAFEYLS 149

  Fly   163 NLKTLNLGYNDLHSLDADLFEHIPHIEELVLCSNSFHVIDQLSETAISGLQSLKILDVSYMEIDD 227
            .||.|.|..|.:.|:.:|.|..:|.:..|.|  .....:..:|..|..||.:|:.|::....:.:
Zfish   150 KLKELWLRNNPIESIPSDAFSRLPSLRRLDL--GELKRLSYISSGAFQGLSNLRYLNLGMCNLKE 212

  Fly   228 LPDTILHGPRDLEIFIAAGNLFNQLPKALKYATNLTSLVLNENPIENLIGDNVFPP--LTKLTHL 290
            :|:                         ::....|..|.::.|.:      .|..|  ...|.||
Zfish   213 VPN-------------------------IQPLIRLDELEMSGNQL------TVIQPSSFKGLVHL 246

  Fly   291 SMTFM--SKLYKIGPGAFSELQSLTELILSDNKLLNEIDEEALSKNVTGGQYLDYPPLEKVYLNN 353
            ...:|  :::..|...:|.:|.||.||.|:.|                                 
Zfish   247 QKLWMMHAQVQTIERNSFDDLHSLRELNLAHN--------------------------------- 278

  Fly   354 CNVSTLPKELLVRWDKLKALDLRFNPWNCDESNDFLINVLIDRINKTTPVLAKDVKCGGPNKL 416
             |::.||.:|......|:.:.|..|||||:....:|...|.:.:...|...|   :|..|..|
Zfish   279 -NLTFLPHDLYTPLHHLQRVHLHHNPWNCNCDILWLSWWLRETVPTNTSCCA---RCNSPPSL 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5096NP_723576.1 LRR_RI 69..378 CDD:238064 73/319 (23%)
leucine-rich repeat 85..104 CDD:275380 4/18 (22%)
LRR_8 105..174 CDD:290566 28/68 (41%)
leucine-rich repeat 105..128 CDD:275380 10/22 (45%)
leucine-rich repeat 129..163 CDD:275380 12/33 (36%)
LRR_8 163..222 CDD:290566 17/58 (29%)
leucine-rich repeat 164..187 CDD:275380 8/22 (36%)
leucine-rich repeat 188..214 CDD:275380 6/25 (24%)
leucine-rich repeat 215..238 CDD:275380 3/22 (14%)
leucine-rich repeat 239..261 CDD:275380 0/21 (0%)
LRR_8 260..322 CDD:290566 18/65 (28%)
leucine-rich repeat 262..286 CDD:275380 5/25 (20%)
leucine-rich repeat 287..311 CDD:275380 7/25 (28%)
leucine-rich repeat 346..369 CDD:275380 4/22 (18%)
leucine-rich repeat 370..388 CDD:275380 7/17 (41%)
lrrc4cbXP_005166545.1 LRRNT 48..81 CDD:214470 7/39 (18%)
LRR_8 77..137 CDD:290566 22/65 (34%)
leucine-rich repeat 79..102 CDD:275380 5/28 (18%)
LRR_RI 82..>281 CDD:238064 65/280 (23%)
leucine-rich repeat 103..126 CDD:275380 10/22 (45%)
LRR_8 125..180 CDD:290566 23/65 (35%)
leucine-rich repeat 127..150 CDD:275380 12/33 (36%)
leucine-rich repeat 151..174 CDD:275380 8/22 (36%)
leucine-rich repeat 175..199 CDD:275380 6/25 (24%)
leucine-rich repeat 200..221 CDD:275380 3/45 (7%)
LRR_8 221..280 CDD:290566 18/98 (18%)
leucine-rich repeat 222..245 CDD:275380 6/28 (21%)
leucine-rich repeat 246..269 CDD:275380 5/22 (23%)
leucine-rich repeat 270..291 CDD:275380 9/54 (17%)
LRRCT 302..352 CDD:214507 12/39 (31%)
I-set 355..443 CDD:254352
Ig 372..439 CDD:143165
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.