DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5096 and LRRN3

DIOPT Version :9

Sequence 1:NP_723576.1 Gene:CG5096 / 34410 FlyBaseID:FBgn0032235 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001093128.1 Gene:LRRN3 / 54674 HGNCID:17200 Length:708 Species:Homo sapiens


Alignment Length:378 Identity:96/378 - (25%)
Similarity:160/378 - (42%) Gaps:57/378 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 IKVIDSKL-CKK-CNC-----------YIDTNLLDCSE----KLQDWLSAEDWEDLTNGNVVFKT 86
            ::.:|.|: |.: |.|           |::.:.:||::    .....|.|.....|...|.:.|.
Human    20 VQAVDKKVDCPRLCTCEIRPWFTPRSIYMEASTVDCNDLGLLTFPARLPANTQILLLQTNNIAKI 84

  Fly    87 ------------INLEHNNLTSVP---ILPKYDVENLYLANNQIDSISVGAFQNLTELVTLDLSH 136
                        ::|..|||:||.   :.....:.::||..|::..:.......|:.|..|.::|
Human    85 EYSTDFPVNLTGLDLSQNNLSSVTNINVKKMPQLLSVYLEENKLTELPEKCLSELSNLQELYINH 149

  Fly   137 NRLTSKVLVPDVFKGPFTVQDFESLENLKTLNLGYNDLHSLDADLFEHIPHIEELVLCSNSFHVI 201
            |.|::  :.|..|.|         |.||..|:|..|.|..:::..|:.:|::|.|::..|....|
Human   150 NLLST--ISPGAFIG---------LHNLLRLHLNSNRLQMINSKWFDALPNLEILMIGENPIIRI 203

  Fly   202 DQLSETAISGLQSLKILDVSYMEIDDLPDTILHGPRDLEIFIAAGNLFNQLPK-ALKYATNLTSL 265
            ..::...:..|:||.|..::..||   ||..|.|..:||......|...::|. ||:...||..|
Human   204 KDMNFKPLINLRSLVIAGINLTEI---PDNALVGLENLESISFYDNRLIKVPHVALQKVVNLKFL 265

  Fly   266 VLNENPIENLIGDNVFPPLTKLTHLSMTFMSKLYKIGPGAFSELQSLTELILSDNKLLNEIDEEA 330
            .||:||| |.|....|..:..|..|.:..|.:|..|...|...|..|.::..::|..|:.|...|
Human   266 DLNKNPI-NRIRRGDFSNMLHLKELGINNMPELISIDSLAVDNLPDLRKIEATNNPRLSYIHPNA 329

  Fly   331 LSKNVTGGQYLDYPPLEKVYLNNCNVSTLPKELLVRWDKLKALDLRFNPWNCD 383
                     :...|.||.:.||:..:|.|....:.....||.:.:..||..||
Human   330 ---------FFRLPKLESLMLNSNALSALYHGTIESLPNLKEISIHSNPIRCD 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5096NP_723576.1 LRR_RI 69..378 CDD:238064 84/324 (26%)
leucine-rich repeat 85..104 CDD:275380 7/33 (21%)
LRR_8 105..174 CDD:290566 18/68 (26%)
leucine-rich repeat 105..128 CDD:275380 4/22 (18%)
leucine-rich repeat 129..163 CDD:275380 9/33 (27%)
LRR_8 163..222 CDD:290566 16/58 (28%)
leucine-rich repeat 164..187 CDD:275380 6/22 (27%)
leucine-rich repeat 188..214 CDD:275380 5/25 (20%)
leucine-rich repeat 215..238 CDD:275380 8/22 (36%)
leucine-rich repeat 239..261 CDD:275380 6/22 (27%)
LRR_8 260..322 CDD:290566 20/61 (33%)
leucine-rich repeat 262..286 CDD:275380 10/23 (43%)
leucine-rich repeat 287..311 CDD:275380 7/23 (30%)
leucine-rich repeat 346..369 CDD:275380 6/22 (27%)
leucine-rich repeat 370..388 CDD:275380 6/14 (43%)
LRRN3NP_001093128.1 LRRNT 28..72 CDD:214470 8/43 (19%)
LRR 1 70..91 3/20 (15%)
leucine-rich repeat 72..93 CDD:275380 3/20 (15%)
LRR <75..355 CDD:227223 80/303 (26%)
LRR 2 93..114 6/20 (30%)
leucine-rich repeat 94..117 CDD:275380 6/22 (27%)
LRR 3 117..138 3/20 (15%)
leucine-rich repeat 118..141 CDD:275380 4/22 (18%)
LRR 4 141..162 7/22 (32%)
leucine-rich repeat 142..165 CDD:275380 9/33 (27%)
LRR 5 165..186 7/20 (35%)
leucine-rich repeat 166..189 CDD:275380 6/22 (27%)
LRR 6 189..210 4/20 (20%)
leucine-rich repeat 190..213 CDD:275380 4/22 (18%)
LRR 7 213..234 9/23 (39%)
leucine-rich repeat 214..237 CDD:275380 10/25 (40%)
LRR 8 237..258 6/20 (30%)
leucine-rich repeat 238..261 CDD:275380 6/22 (27%)
LRR 9 261..282 11/21 (52%)
leucine-rich repeat 262..285 CDD:275380 10/23 (43%)
LRR 10 285..304 5/18 (28%)
leucine-rich repeat 286..310 CDD:275380 7/23 (30%)
LRR 11 310..332 5/30 (17%)
leucine-rich repeat 311..333 CDD:275380 5/30 (17%)
LRR 12 335..358 6/22 (27%)
leucine-rich repeat 336..359 CDD:275380 6/22 (27%)
PCC 341..>442 CDD:188093 10/33 (30%)
Ig 437..513 CDD:325142
fn3 526..593 CDD:306538
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.