DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5096 and Tollo

DIOPT Version :10

Sequence 1:NP_723576.1 Gene:CG5096 / 34410 FlyBaseID:FBgn0032235 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_524757.1 Gene:Tollo / 44497 FlyBaseID:FBgn0029114 Length:1346 Species:Drosophila melanogaster


Alignment Length:361 Identity:93/361 - (25%)
Similarity:155/361 - (42%) Gaps:62/361 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 LDCSEKLQDWLSAEDWEDLTNGNVVFKTINLEHNNLTSVPILPKY-----DVENLYLANNQIDSI 118
            |:.::....:|:...:|.|.:    .:.::|..|.|||:|  |:.     .::.:||.||.|:.:
  Fly   239 LNMAKNSMSFLADRAFEGLLS----LRVVDLSANRLTSLP--PELFAETKQLQEIYLRNNSINVL 297

  Fly   119 SVGAFQNLTELVTLDLSHNRLTSKVLVPDVFKG---------------PFTVQDFESLENLKTLN 168
            :.|.|..|.||:.|||:.|.|.|:.:....|.|               ......|..|.:|:.|.
  Fly   298 APGIFGELAELLVLDLASNELNSQWINAATFVGLKRLMMLDLSANKISRLEAHIFRPLASLQILK 362

  Fly   169 LGYNDLHSLDADLFEHIPHIEELVLCSNSFHVIDQLSETAISGLQSLKILDVSYMEIDDLPDTIL 233
            |..|.:..|...:|..:.::..|:|..|...||:|   ..:.||::|.:|.:.:..|..:....|
  Fly   363 LEDNYIDQLPGGIFADLTNLHTLILSRNRISVIEQ---RTLQGLKNLLVLSLDFNRISRMDQRSL 424

  Fly   234 HGPRDLEIFIAAGNLFNQLPKALKYATNLTSLVLNENPIENLIGDNVFPPLTKLTHLSMTFMSKL 298
            .....|:......|....:|:||.:...|.:|.:.||.|..:...:: ..|..|..|.|| .:.|
  Fly   425 VNCSQLQDLHLNDNKLQAVPEALAHVQLLKTLDVGENMISQIENTSI-TQLESLYGLRMT-ENSL 487

  Fly   299 YKIGPGAFSELQSLTELILSDNKLLNEIDEEALSKN-------VTGGQ-------YLDYPPLEKV 349
            ..|..|.|..:.||..|.||.|| |..|:..:|.:|       :.|.|       :.:.|.|  |
  Fly   488 THIRRGVFDRMSSLQILNLSQNK-LKSIEAGSLQRNSQLQAIRLDGNQLKSIAGLFTELPNL--V 549

  Fly   350 YLN-------NCNVSTLPKELLVRWDKLKALDLRFN 378
            :||       ..:.|.:|  :.::|     ||:|.|
  Fly   550 WLNISGNRLEKFDYSHIP--IGLQW-----LDVRAN 578

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5096NP_723576.1 LRR 54..>322 CDD:443914 74/282 (26%)
leucine-rich repeat 85..104 CDD:275380 7/23 (30%)
leucine-rich repeat 105..128 CDD:275380 8/22 (36%)
leucine-rich repeat 129..163 CDD:275380 11/48 (23%)
leucine-rich repeat 164..187 CDD:275380 6/22 (27%)
leucine-rich repeat 188..214 CDD:275380 8/25 (32%)
leucine-rich repeat 215..238 CDD:275380 4/22 (18%)
leucine-rich repeat 239..261 CDD:275380 5/21 (24%)
leucine-rich repeat 262..286 CDD:275380 6/23 (26%)
leucine-rich repeat 287..311 CDD:275380 8/23 (35%)
leucine-rich repeat 346..369 CDD:275380 7/29 (24%)
leucine-rich repeat 370..388 CDD:275380 4/9 (44%)
TolloNP_524757.1 LRR 54..400 CDD:443914 43/169 (25%)
leucine-rich repeat 100..123 CDD:275380
leucine-rich repeat 124..144 CDD:275380
leucine-rich repeat 154..177 CDD:275380
leucine-rich repeat 178..201 CDD:275380
leucine-rich repeat 212..235 CDD:275380
leucine-rich repeat 236..259 CDD:275380 4/19 (21%)
LRR 239..634 CDD:443914 93/361 (26%)
leucine-rich repeat 260..283 CDD:275380 7/24 (29%)
leucine-rich repeat 284..307 CDD:275380 8/22 (36%)
leucine-rich repeat 308..333 CDD:275380 9/24 (38%)
leucine-rich repeat 334..357 CDD:275380 2/22 (9%)
leucine-rich repeat 358..381 CDD:275380 6/22 (27%)
leucine-rich repeat 382..405 CDD:275380 8/25 (32%)
leucine-rich repeat 406..429 CDD:275380 4/22 (18%)
leucine-rich repeat 430..452 CDD:275380 5/21 (24%)
leucine-rich repeat 453..500 CDD:275380 14/48 (29%)
leucine-rich repeat 501..521 CDD:275380 9/20 (45%)
leucine-rich repeat 525..547 CDD:275380 2/21 (10%)
leucine-rich repeat 548..573 CDD:275380 7/33 (21%)
leucine-rich repeat 604..640 CDD:275380
LRR_8 616..>660 CDD:404697
leucine-rich repeat 641..688 CDD:275380
leucine-rich repeat 689..816 CDD:275380
LRR <794..>920 CDD:443914
leucine-rich repeat 817..864 CDD:275380
leucine-rich repeat 865..888 CDD:275380
leucine-rich repeat 889..910 CDD:275380
TIR 1076..1211 CDD:214587
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.