DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5096 and Tollo

DIOPT Version :9

Sequence 1:NP_723576.1 Gene:CG5096 / 34410 FlyBaseID:FBgn0032235 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_524757.1 Gene:Tollo / 44497 FlyBaseID:FBgn0029114 Length:1346 Species:Drosophila melanogaster


Alignment Length:361 Identity:93/361 - (25%)
Similarity:155/361 - (42%) Gaps:62/361 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 LDCSEKLQDWLSAEDWEDLTNGNVVFKTINLEHNNLTSVPILPKY-----DVENLYLANNQIDSI 118
            |:.::....:|:...:|.|.:    .:.::|..|.|||:|  |:.     .::.:||.||.|:.:
  Fly   239 LNMAKNSMSFLADRAFEGLLS----LRVVDLSANRLTSLP--PELFAETKQLQEIYLRNNSINVL 297

  Fly   119 SVGAFQNLTELVTLDLSHNRLTSKVLVPDVFKG---------------PFTVQDFESLENLKTLN 168
            :.|.|..|.||:.|||:.|.|.|:.:....|.|               ......|..|.:|:.|.
  Fly   298 APGIFGELAELLVLDLASNELNSQWINAATFVGLKRLMMLDLSANKISRLEAHIFRPLASLQILK 362

  Fly   169 LGYNDLHSLDADLFEHIPHIEELVLCSNSFHVIDQLSETAISGLQSLKILDVSYMEIDDLPDTIL 233
            |..|.:..|...:|..:.::..|:|..|...||:|   ..:.||::|.:|.:.:..|..:....|
  Fly   363 LEDNYIDQLPGGIFADLTNLHTLILSRNRISVIEQ---RTLQGLKNLLVLSLDFNRISRMDQRSL 424

  Fly   234 HGPRDLEIFIAAGNLFNQLPKALKYATNLTSLVLNENPIENLIGDNVFPPLTKLTHLSMTFMSKL 298
            .....|:......|....:|:||.:...|.:|.:.||.|..:...:: ..|..|..|.|| .:.|
  Fly   425 VNCSQLQDLHLNDNKLQAVPEALAHVQLLKTLDVGENMISQIENTSI-TQLESLYGLRMT-ENSL 487

  Fly   299 YKIGPGAFSELQSLTELILSDNKLLNEIDEEALSKN-------VTGGQ-------YLDYPPLEKV 349
            ..|..|.|..:.||..|.||.|| |..|:..:|.:|       :.|.|       :.:.|.|  |
  Fly   488 THIRRGVFDRMSSLQILNLSQNK-LKSIEAGSLQRNSQLQAIRLDGNQLKSIAGLFTELPNL--V 549

  Fly   350 YLN-------NCNVSTLPKELLVRWDKLKALDLRFN 378
            :||       ..:.|.:|  :.::|     ||:|.|
  Fly   550 WLNISGNRLEKFDYSHIP--IGLQW-----LDVRAN 578

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5096NP_723576.1 LRR_RI 69..378 CDD:238064 91/349 (26%)
leucine-rich repeat 85..104 CDD:275380 7/23 (30%)
LRR_8 105..174 CDD:290566 24/83 (29%)
leucine-rich repeat 105..128 CDD:275380 8/22 (36%)
leucine-rich repeat 129..163 CDD:275380 11/48 (23%)
LRR_8 163..222 CDD:290566 16/58 (28%)
leucine-rich repeat 164..187 CDD:275380 6/22 (27%)
leucine-rich repeat 188..214 CDD:275380 8/25 (32%)
leucine-rich repeat 215..238 CDD:275380 4/22 (18%)
leucine-rich repeat 239..261 CDD:275380 5/21 (24%)
LRR_8 260..322 CDD:290566 20/61 (33%)
leucine-rich repeat 262..286 CDD:275380 6/23 (26%)
leucine-rich repeat 287..311 CDD:275380 8/23 (35%)
leucine-rich repeat 346..369 CDD:275380 7/29 (24%)
leucine-rich repeat 370..388 CDD:275380 4/9 (44%)
TolloNP_524757.1 LRR_RI <85..281 CDD:238064 11/47 (23%)
leucine-rich repeat 100..123 CDD:275380
leucine-rich repeat 124..144 CDD:275380
LRR_8 152..222 CDD:290566
leucine-rich repeat 154..177 CDD:275380
leucine-rich repeat 178..201 CDD:275380
LRR 210..656 CDD:227223 93/361 (26%)
leucine-rich repeat 212..235 CDD:275380
leucine-rich repeat 236..259 CDD:275380 4/19 (21%)
leucine-rich repeat 260..283 CDD:275380 7/24 (29%)
LRR_RI 276..558 CDD:238064 75/289 (26%)
leucine-rich repeat 284..307 CDD:275380 8/22 (36%)
leucine-rich repeat 308..333 CDD:275380 9/24 (38%)
leucine-rich repeat 334..357 CDD:275380 2/22 (9%)
leucine-rich repeat 358..381 CDD:275380 6/22 (27%)
leucine-rich repeat 382..405 CDD:275380 8/25 (32%)
leucine-rich repeat 406..429 CDD:275380 4/22 (18%)
leucine-rich repeat 430..452 CDD:275380 5/21 (24%)
leucine-rich repeat 453..500 CDD:275380 14/48 (29%)
leucine-rich repeat 501..521 CDD:275380 9/20 (45%)
leucine-rich repeat 525..547 CDD:275380 2/21 (10%)
leucine-rich repeat 548..573 CDD:275380 7/33 (21%)
leucine-rich repeat 604..640 CDD:275380
leucine-rich repeat 641..688 CDD:275380
leucine-rich repeat 689..816 CDD:275380
LRR_8 815..875 CDD:290566
leucine-rich repeat 817..864 CDD:275380
LRR_8 864..921 CDD:290566
leucine-rich repeat 865..888 CDD:275380
leucine-rich repeat 889..910 CDD:275380
TIR 1076..1211 CDD:214587
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45617
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.