DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5096 and CG5810

DIOPT Version :9

Sequence 1:NP_723576.1 Gene:CG5096 / 34410 FlyBaseID:FBgn0032235 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_650952.2 Gene:CG5810 / 42513 FlyBaseID:FBgn0038866 Length:428 Species:Drosophila melanogaster


Alignment Length:446 Identity:103/446 - (23%)
Similarity:167/446 - (37%) Gaps:133/446 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 TTETPKEKIKVIDSKLCKKCNCYIDTNLLDCSEKLQDWLSAEDWEDLTNGNVVFKTINLEHNNLT 95
            |.|:.|.:...|||..|::..|   |||...|.....:.|    |::|.....::|:.|..::|.
  Fly    19 TCESQKLEEIAIDSLDCRENTC---TNLKYPSASAVAYFS----ENVTKHLRKYETLVLHSSDLA 76

  Fly    96 SVP-----ILPK------------------YD----------------------------VENLY 109
            ::|     .||:                  :|                            :|.|.
  Fly    77 NLPRKIFLNLPQLVEFHVLECELQQIESVCFDGAKNLKRLNFGGNALRVLDSNTFELATQLEELN 141

  Fly   110 LANNQIDSISVGAFQNLTELVTLDLSHNRLTSKVLVPDVFKGPFTVQDFESLENLKTLNLGYNDL 174
            |::||::.:....|:.|..|..::||:|||.:           .:...|..|.:||::|:..|.|
  Fly   142 LSDNQLEDLPTTIFRPLKNLQKINLSNNRLIT-----------LSQHIFSQLGSLKSINVDSNQL 195

  Fly   175 HSLDADLF-EHIPHIEELVLCSNS--------FHVIDQLSETAISGLQSLKI-----------LD 219
            ..|..:|| :...|:.|....||.        |..||.||.:....|:.|.:           .|
  Fly   196 VELPGELFRDQRKHLSEFSAQSNQLVRIPFNIFREIDHLSLSFNPQLRRLHLSAKINELEATNCD 260

  Fly   220 VSYMEID------------DLPDTILHGPRDLE-IFIAAGNLFNQLPKALKYATNLTSLV-LNEN 270
            :..:|:|            .|.:..:..|:||| :::|..||:.     |.:.:..:.|| |:..
  Fly   261 LESVELDGRVIGVQLEANPKLHELKISQPQDLEHLYLANTNLYR-----LDFLSKASKLVDLDVT 320

  Fly   271 PIENLIGDNVFPPLTK---LTHLSMTFMSKLYKIGPGAFSELQSLTELILSDNK----LLNEIDE 328
            .|.||..   .|.:|.   |..||.|: ..|..........|:.|..|.:|..|    .:.::||
  Fly   321 DIVNLAD---LPKITSAKGLERLSFTY-DNLTSNHMDMLPHLKDLNYLEISHEKGKEIFIKDLDE 381

  Fly   329 EAL--SKNVTGGQYLDYPPLEKVYLNNCNVSTLPKELLVRWDKLKALDLRFNPWNC 382
            :..  ...:..||..|.  ||.|        .|||:..:..|:|.. |.| .|..|
  Fly   382 DFFVEEAELNCGQLADL--LEFV--------ELPKDTTILEDRLVG-DPR-GPMRC 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5096NP_723576.1 LRR_RI 69..378 CDD:238064 89/402 (22%)
leucine-rich repeat 85..104 CDD:275380 6/41 (15%)
LRR_8 105..174 CDD:290566 19/68 (28%)
leucine-rich repeat 105..128 CDD:275380 7/22 (32%)
leucine-rich repeat 129..163 CDD:275380 8/33 (24%)
LRR_8 163..222 CDD:290566 20/78 (26%)
leucine-rich repeat 164..187 CDD:275380 8/23 (35%)
leucine-rich repeat 188..214 CDD:275380 9/33 (27%)
leucine-rich repeat 215..238 CDD:275380 6/45 (13%)
leucine-rich repeat 239..261 CDD:275380 6/22 (27%)
LRR_8 260..322 CDD:290566 18/69 (26%)
leucine-rich repeat 262..286 CDD:275380 7/24 (29%)
leucine-rich repeat 287..311 CDD:275380 6/23 (26%)
leucine-rich repeat 346..369 CDD:275380 6/22 (27%)
leucine-rich repeat 370..388 CDD:275380 5/13 (38%)
CG5810NP_650952.2 leucine-rich repeat 65..88 CDD:275380 5/22 (23%)
LRR_8 87..147 CDD:290566 6/59 (10%)
leucine-rich repeat 89..112 CDD:275380 1/22 (5%)
leucine-rich repeat 113..136 CDD:275380 0/22 (0%)
LRR_8 135..195 CDD:290566 19/70 (27%)
LRR_4 135..175 CDD:289563 13/50 (26%)
leucine-rich repeat 137..160 CDD:275380 7/22 (32%)
leucine-rich repeat 161..184 CDD:275380 8/33 (24%)
leucine-rich repeat 185..209 CDD:275380 8/23 (35%)
leucine-rich repeat 210..231 CDD:275380 4/20 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45617
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.