DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5096 and chad

DIOPT Version :9

Sequence 1:NP_723576.1 Gene:CG5096 / 34410 FlyBaseID:FBgn0032235 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_957357.1 Gene:chad / 394038 ZFINID:ZDB-GENE-040426-1130 Length:363 Species:Danio rerio


Alignment Length:364 Identity:82/364 - (22%)
Similarity:133/364 - (36%) Gaps:115/364 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 KCNCYIDTNLLDCSEKLQDWLSAEDWEDLTNGNVVFKTI----------NLEHNNLTSVPILPKY 103
            :|:|:.|...:.|.                  ||..|.|          ||:.|||.::|     
Zfish    30 QCHCHGDLQHVICD------------------NVGLKKIPRISEATRLLNLQRNNLGNLP----- 71

  Fly   104 DVENLYLANNQIDSISVGAFQNLTELVTLDLSHNRLTSKVLVPDVFKGPFTVQDFESLENLKTLN 168
                            .|.|..:..|::|.|.|.::  :.|....|||         |..|..|.
Zfish    72 ----------------TGGFSEMKGLISLHLQHCQI--RELSGQAFKG---------LNKLIYLY 109

  Fly   169 LGYNDLHSLDADLFEHIPHIEELVLCSNSFHVIDQLSETAISGLQSLKILDVSYMEIDDLPDTIL 233
            |..|::.::....||.:..:..|.|..|.   |..|.:...|.:.:|.||.::..::.:|.....
Zfish   110 LSDNEISTIKPGAFEDLTELTYLYLDGNQ---ITSLPKGIFSPMINLFILQLNNNKLRELQPGTF 171

  Fly   234 HGPRDLEIFIAAGNLFNQL-PKALKYATNLTSLVLNENPIENLIGDNVFPPLTKLTHLSMTFMSK 297
            .|.:||.....:||..:.: |.:|....||..|.|::|   ||   :.:|.|             
Zfish   172 KGAKDLRWLYMSGNELSSIQPGSLDEVENLAILTLDQN---NL---STYPLL------------- 217

  Fly   298 LYKIGPGAFSELQSLTELILSDNKL-------------------LNEIDEEALSKNVTGGQYLDY 343
                   |.|:|:.:.||.||.|.|                   ||::..|..|.....|    .
Zfish   218 -------AMSKLRVVEELNLSKNPLSLIPDHAFRSFGRYMEKLHLNDMSLEKFSNAAFEG----V 271

  Fly   344 PPLEKVYLNNCNVSTLPKELLVRWDKLKALDLRFNPWNC 382
            ..|:.::|.|..:.:||..|  .:..::.:.|..|||:|
Zfish   272 TALKSLHLENNKLRSLPNSL--EFSTIQNITLFNNPWSC 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5096NP_723576.1 LRR_RI 69..378 CDD:238064 74/338 (22%)
leucine-rich repeat 85..104 CDD:275380 8/28 (29%)
LRR_8 105..174 CDD:290566 15/68 (22%)
leucine-rich repeat 105..128 CDD:275380 2/22 (9%)
leucine-rich repeat 129..163 CDD:275380 9/33 (27%)
LRR_8 163..222 CDD:290566 15/58 (26%)
leucine-rich repeat 164..187 CDD:275380 6/22 (27%)
leucine-rich repeat 188..214 CDD:275380 6/25 (24%)
leucine-rich repeat 215..238 CDD:275380 5/22 (23%)
leucine-rich repeat 239..261 CDD:275380 5/22 (23%)
LRR_8 260..322 CDD:290566 17/61 (28%)
leucine-rich repeat 262..286 CDD:275380 8/23 (35%)
leucine-rich repeat 287..311 CDD:275380 3/23 (13%)
leucine-rich repeat 346..369 CDD:275380 6/22 (27%)
leucine-rich repeat 370..388 CDD:275380 5/13 (38%)
chadNP_957357.1 LRRNT 26..52 CDD:279764 8/39 (21%)
leucine-rich repeat 57..80 CDD:275380 8/43 (19%)
LRR_8 79..139 CDD:290566 18/73 (25%)
leucine-rich repeat 81..104 CDD:275380 9/33 (27%)
LRR_RI <96..304 CDD:238064 57/251 (23%)
LRR_4 104..143 CDD:289563 10/41 (24%)
leucine-rich repeat 105..128 CDD:275380 6/22 (27%)
LRR_8 127..187 CDD:290566 15/62 (24%)
leucine-rich repeat 129..152 CDD:275380 6/25 (24%)
leucine-rich repeat 153..176 CDD:275380 5/22 (23%)
LRR_8 177..235 CDD:290566 22/83 (27%)
leucine-rich repeat 177..200 CDD:275380 5/22 (23%)
leucine-rich repeat 201..224 CDD:275380 11/48 (23%)
LRR_8 225..284 CDD:290566 14/62 (23%)
leucine-rich repeat 225..248 CDD:275380 6/22 (27%)
leucine-rich repeat 250..273 CDD:275380 5/26 (19%)
LRRCT 304..351 CDD:214507 4/5 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D334557at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.