DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5096 and CG4781

DIOPT Version :9

Sequence 1:NP_723576.1 Gene:CG5096 / 34410 FlyBaseID:FBgn0032235 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_611951.1 Gene:CG4781 / 37943 FlyBaseID:FBgn0035043 Length:469 Species:Drosophila melanogaster


Alignment Length:494 Identity:113/494 - (22%)
Similarity:202/494 - (40%) Gaps:120/494 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 KIKVIDSKLCKKCNCYIDTN-----LLDCSEKLQDWLSAEDWEDLTNGN------VVFKTINLEH 91
            :.:|||::...:. ||.:::     ..:||.     :||..|     ||      ..:|...:..
  Fly    26 RAEVIDAEETDRF-CYPESSKNSRRSCECSN-----VSASPW-----GNRALRIDCSYKDYKVAD 79

  Fly    92 NNLTSVPILPKYDVENLYLANNQIDSISVGAFQNLTELVTLDLSHNRLTSKVLVPDVFKGPFTVQ 156
            .:|    :||.| :::|.|:.|.:||:.:....:|.:   |:|.||.::..|      .|     
  Fly    80 LSL----LLPLY-IDSLDLSWNALDSVPIFTSDSLHQ---LNLRHNNISQLV------SG----- 125

  Fly   157 DFESLENLKTLNLGYNDLHSLDADLFEHIPHIEELVLCSNSFHVIDQLSETAISGLQSLKILDVS 221
            :|:.|.:|:.|.||:|.:..|::..|:.:||::.|.|..|:.|:   |.....:.|..|..||:|
  Fly   126 NFKQLTSLRELYLGWNSIGKLESGSFDGLPHLQVLDLAHNNLHL---LPGHLFAPLLVLGTLDIS 187

  Fly   222 Y-----------------------MEIDDLPDTILHGP-----RDLEIFIAAGNLFNQLPKALKY 258
            :                       :.:|......||.|     ::|.:   ..|...::|..|  
  Fly   188 WNRRFNESGGDLYTGLGVNWKLSTLRLDACSLNDLHLPVNAPLKELSL---RRNQLKRIPTQL-- 247

  Fly   259 ATNLTSLVLNENPIENLIGDNVFPPLTKLTHLSMTFMSKLYKIGPGAFSELQSLTELILSDNKLL 323
            ...|..|.:::|.:|.|:.::. ..||::..|.:..|..|.::...:.:.:..|..|...:::.|
  Fly   248 PETLLRLDISDNLLEELLPEDT-ANLTQVRQLFIEDMPVLQRVVANSLTHVDVLETLSFQNSRQL 311

  Fly   324 NEIDEEALSKNVTGGQYLDYPPLEKVYLNNCN-----VSTLPKELLVRWDKLKALDLRFNPWNCD 383
            :.:|.||....:|       .|.:|..|.:.:     :.|....|...:.:|..|||...|..||
  Fly   312 SHLDAEAFGPIMT-------TPTKKRALRSLSFRGTMLRTFNSTLAPIFTQLAELDLNGLPLQCD 369

  Fly   384 ESNDFLINVLIDRINKTTPVLAKDVKCGGPNKLNDVTLLRVANEHMIESSTGSLI-------WV- 440
            ....:|         |..||.... :|..|.::..:         ::.|:.|...       |. 
  Fly   370 CELVWL---------KQLPVQTNG-RCYKPARIRGM---------LVTSARGDAFSCDTWPRWAY 415

  Fly   441 GLLVVLLIAVPTIIGAY--VMKRRGCFGVFRRHDSGASS 477
            ||:|:.|||: :..|.|  ||..|...||..|...||.|
  Fly   416 GLVVLSLIAL-SAAGIYLIVMGLRPHRGVTMRRKVGAGS 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5096NP_723576.1 LRR_RI 69..378 CDD:238064 77/347 (22%)
leucine-rich repeat 85..104 CDD:275380 4/18 (22%)
LRR_8 105..174 CDD:290566 19/68 (28%)
leucine-rich repeat 105..128 CDD:275380 6/22 (27%)
leucine-rich repeat 129..163 CDD:275380 8/33 (24%)
LRR_8 163..222 CDD:290566 18/58 (31%)
leucine-rich repeat 164..187 CDD:275380 7/22 (32%)
leucine-rich repeat 188..214 CDD:275380 6/25 (24%)
leucine-rich repeat 215..238 CDD:275380 8/50 (16%)
leucine-rich repeat 239..261 CDD:275380 4/21 (19%)
LRR_8 260..322 CDD:290566 12/61 (20%)
leucine-rich repeat 262..286 CDD:275380 6/23 (26%)
leucine-rich repeat 287..311 CDD:275380 3/23 (13%)
leucine-rich repeat 346..369 CDD:275380 4/27 (15%)
leucine-rich repeat 370..388 CDD:275380 7/17 (41%)
CG4781NP_611951.1 leucine-rich repeat 90..108 CDD:275380 5/17 (29%)
LRR_8 108..167 CDD:290566 21/72 (29%)
leucine-rich repeat 109..132 CDD:275380 9/36 (25%)
LRR_RI <121..>261 CDD:238064 34/158 (22%)
leucine-rich repeat 133..156 CDD:275380 7/22 (32%)
leucine-rich repeat 157..180 CDD:275380 6/25 (24%)
leucine-rich repeat 181..208 CDD:275380 4/26 (15%)
leucine-rich repeat 230..253 CDD:275380 5/27 (19%)
leucine-rich repeat 254..274 CDD:275380 5/20 (25%)
leucine-rich repeat 275..299 CDD:275380 3/23 (13%)
leucine-rich repeat 300..319 CDD:275380 5/18 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG28173
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45617
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.