DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5096 and CG14762

DIOPT Version :9

Sequence 1:NP_723576.1 Gene:CG5096 / 34410 FlyBaseID:FBgn0032235 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001246198.1 Gene:CG14762 / 35768 FlyBaseID:FBgn0033250 Length:498 Species:Drosophila melanogaster


Alignment Length:452 Identity:108/452 - (23%)
Similarity:181/452 - (40%) Gaps:90/452 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 TKSATLAAAIFCIVLSQVSGQTKDETTTTETPKEKIKVIDSKLCKKCNCYIDTNLLDCSEKLQDW 68
            |...|:...:..:|:.||.||...:|.......|         ...|.|.:..|.||...:..|.
  Fly    11 TMVVTVVLLLQVLVMDQVLGQGPPQTQVCPEQSE---------IAPCICTVKKNGLDILCETTDL 66

  Fly    69 LS-AEDWEDLTNGNVVFKTINLEHNNLTSVP--ILPKYDVENLYLAN------------------ 112
            .. .:....|...:.:...:.|.||||..:.  :....|:.:|.:.|                  
  Fly    67 AHITKSMGTLKGKSPIIFYLKLRHNNLPKLQGFVFLALDIRHLTIHNSSLAAIEENALSSLGAGL 131

  Fly   113 -------NQIDSISVGAFQNLTELVTLDLSHNRLTSKVLVPDVFKGPFTVQDFESLENLKTLNLG 170
                   ||:.::...|.|:|..|:.|:|:||::|  |:..:.|:|         ||.|:.|.|.
  Fly   132 TQLDVSLNQMKTVPSQALQHLFHLLILNLNHNKIT--VIHNNAFEG---------LETLEILTLY 185

  Fly   171 YNDLHSLDADLFEHI-PHIEELVLCSNSFHVIDQLSETAISGLQSLKILDVSYMEIDDLPDTILH 234
            .|.:..:|.:.|..: .||:.|.|..|.   :..:.:.|:|.|.:||.|::...:|..:.:....
  Fly   186 ENKITQIDPEAFRGLEDHIKRLNLGGND---LTNIPQKALSILSTLKKLEIQENKIRTISEGDFE 247

  Fly   235 GPRDLEIFIAAGNLFNQLP-KALKYATNLTSLVLNENPI------------ENL----IGDN--- 279
            |.:.|:..|.|.|:...:| ....:.|.|.||.|..|.|            |||    :|||   
  Fly   248 GLQSLDSLILAHNMITTVPANVFSHLTLLNSLELEGNKISVIDKDAFKGLEENLQYLRLGDNQIH 312

  Fly   280 -----VFPPLTKLTHLSMTFMSKLYKIGPGAFSEL-QSLTELILSDNKLLNEIDEEALSKNVTGG 338
                 ...||.:|.||.:. .:.:..:...||:.. .|||.|.|..|.:  ::....|.:|:.. 
  Fly   313 TIPSEALRPLHRLRHLDLR-NNNINVLAEDAFTGFGDSLTFLNLQKNDI--KVLPSLLFENLNS- 373

  Fly   339 QYLDYPPLEKVYLNNCNVSTLPKELLVR-WDKLKALDLRFNPWNCDESNDFLINVLIDRINK 399
                   ||.:.|.|..:..:|::::.. .|.|:.:|:..||.||.....:...:|.|..||
  Fly   374 -------LETLNLQNNKLQRIPQDIMEPVIDTLRIIDITDNPLNCSCELTWFPKLLEDLKNK 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5096NP_723576.1 LRR_RI 69..378 CDD:238064 85/364 (23%)
leucine-rich repeat 85..104 CDD:275380 5/20 (25%)
LRR_8 105..174 CDD:290566 22/93 (24%)
leucine-rich repeat 105..128 CDD:275380 7/47 (15%)
leucine-rich repeat 129..163 CDD:275380 10/33 (30%)
LRR_8 163..222 CDD:290566 17/59 (29%)
leucine-rich repeat 164..187 CDD:275380 6/23 (26%)
leucine-rich repeat 188..214 CDD:275380 7/25 (28%)
leucine-rich repeat 215..238 CDD:275380 5/22 (23%)
leucine-rich repeat 239..261 CDD:275380 5/22 (23%)
LRR_8 260..322 CDD:290566 26/86 (30%)
leucine-rich repeat 262..286 CDD:275380 14/47 (30%)
leucine-rich repeat 287..311 CDD:275380 5/24 (21%)
leucine-rich repeat 346..369 CDD:275380 5/23 (22%)
leucine-rich repeat 370..388 CDD:275380 6/17 (35%)
CG14762NP_001246198.1 leucine-rich repeat 85..105 CDD:275380 5/19 (26%)
LRR_RI 93..384 CDD:238064 76/315 (24%)
leucine-rich repeat 107..129 CDD:275380 2/21 (10%)
leucine-rich repeat 131..154 CDD:275380 5/22 (23%)
LRR_8 154..214 CDD:290566 22/73 (30%)
leucine-rich repeat 155..178 CDD:275380 10/33 (30%)
leucine-rich repeat 179..203 CDD:275380 6/23 (26%)
leucine-rich repeat 204..227 CDD:275380 7/25 (28%)
LRR_8 226..286 CDD:290566 16/59 (27%)
leucine-rich repeat 228..251 CDD:275380 5/22 (23%)
leucine-rich repeat 252..275 CDD:275380 5/22 (23%)
LRR_8 276..335 CDD:290566 17/59 (29%)
leucine-rich repeat 276..300 CDD:275380 6/23 (26%)
leucine-rich repeat 301..324 CDD:275380 6/22 (27%)
leucine-rich repeat 325..349 CDD:275380 5/24 (21%)
LRR_8 349..409 CDD:290566 17/69 (25%)
leucine-rich repeat 350..373 CDD:275380 7/24 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443107
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45617
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.