DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5096 and kek4

DIOPT Version :9

Sequence 1:NP_723576.1 Gene:CG5096 / 34410 FlyBaseID:FBgn0032235 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001260435.1 Gene:kek4 / 34718 FlyBaseID:FBgn0032484 Length:649 Species:Drosophila melanogaster


Alignment Length:364 Identity:82/364 - (22%)
Similarity:132/364 - (36%) Gaps:146/364 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 LLDCSEKLQDWLSAEDWEDLTNGNVVFKTINLEHNNLTSVPILPKYDVENLYLANNQIDSISVGA 122
            ||||......|.|.:            ||.:..:.:|:.||         .||:           
  Fly    39 LLDCGNCHCKWNSGK------------KTADCRNLSLSGVP---------EYLS----------- 71

  Fly   123 FQNLTELVTLDLSHNRLTSKVLVPDVFKGPFTVQDFESLENLKTLNLGYNDLHSLDADLFEHIPH 187
                .|:..||||||.:             |.:::                    :|.|..|:.:
  Fly    72 ----PEVQVLDLSHNHI-------------FYLEE--------------------NAFLTTHLQN 99

  Fly   188 IEELVLCSNSFHVIDQLSETAISGLQSLKILDVS-YMEIDDLPDTILHGPRDLEIFIAAGNLFNQ 251
            :::|::.:.:...::|.|.|.   ||.|..||:| .:.:|.||                 |:|:.
  Fly   100 LQKLLIRNGTLKYLNQRSFTQ---LQILIELDLSNNLLVDLLP-----------------NVFDC 144

  Fly   252 LPKALKYATNLTSLVLNENPIENLIGDNVFPPLTKLTHLSMTFMSKLYKIGPGAFSELQSLTELI 316
            |.|       :.::.||.|.::            .|.|              |.|..|:.|.::.
  Fly   145 LSK-------VRAIFLNGNLLQ------------ALRH--------------GVFRNLKYLHKIE 176

  Fly   317 LSDNKLLNEIDEEALSKNVTGGQYLDYPPLEKVYLNNCNVSTLPKELLVRWDKLKALDLRFNPWN 381
            |..|:|:: ||.:|         ::..|.|.::||:|..::.|..|......||.||.|..||||
  Fly   177 LKRNRLVS-IDAKA---------FVGVPLLSQIYLDNNELTKLRVESFQDLTKLTALSLVENPWN 231

  Fly   382 C----DESNDFLINVLIDRINKTTPVLAKDVKCGGPNKL 416
            |    ....||:|.     :|..||    ...|..|.:|
  Fly   232 CTCDLQMFRDFVIG-----MNLYTP----PTSCHYPLQL 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5096NP_723576.1 LRR_RI 69..378 CDD:238064 63/309 (20%)
leucine-rich repeat 85..104 CDD:275380 5/18 (28%)
LRR_8 105..174 CDD:290566 10/68 (15%)
leucine-rich repeat 105..128 CDD:275380 2/22 (9%)
leucine-rich repeat 129..163 CDD:275380 7/33 (21%)
LRR_8 163..222 CDD:290566 13/59 (22%)
leucine-rich repeat 164..187 CDD:275380 3/22 (14%)
leucine-rich repeat 188..214 CDD:275380 5/25 (20%)
leucine-rich repeat 215..238 CDD:275380 7/23 (30%)
leucine-rich repeat 239..261 CDD:275380 4/21 (19%)
LRR_8 260..322 CDD:290566 11/61 (18%)
leucine-rich repeat 262..286 CDD:275380 3/23 (13%)
leucine-rich repeat 287..311 CDD:275380 5/23 (22%)
leucine-rich repeat 346..369 CDD:275380 6/22 (27%)
leucine-rich repeat 370..388 CDD:275380 9/21 (43%)
kek4NP_001260435.1 leucine-rich repeat 75..99 CDD:275380 10/56 (18%)
LRR_8 99..158 CDD:290566 20/85 (24%)
leucine-rich repeat 100..123 CDD:275380 5/25 (20%)
leucine-rich repeat 124..147 CDD:275380 10/39 (26%)
LRR_8 146..206 CDD:290566 21/102 (21%)
leucine-rich repeat 148..171 CDD:275380 8/48 (17%)
leucine-rich repeat 172..195 CDD:275380 7/32 (22%)
leucine-rich repeat 196..219 CDD:275380 6/22 (27%)
TPKR_C2 228..277 CDD:301599 14/43 (33%)
IG_like 294..390 CDD:214653
Ig 296..387 CDD:143165
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443108
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.