DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5096 and CG42346

DIOPT Version :9

Sequence 1:NP_723576.1 Gene:CG5096 / 34410 FlyBaseID:FBgn0032235 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001036303.2 Gene:CG42346 / 3355160 FlyBaseID:FBgn0259677 Length:1817 Species:Drosophila melanogaster


Alignment Length:510 Identity:125/510 - (24%)
Similarity:201/510 - (39%) Gaps:151/510 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 TETPKEKIKVI---DSKLCK-KCNCYIDT----NLLDCSEKLQDWLSAEDWEDLTNGNVVFKTIN 88
            |.:.::|::::   |::|.: :.:.:.||    .|.....|::| :..:.:.:|    ::.:.::
  Fly   742 TFSRQQKVQIMWLKDNQLTRVERSFFADTPQLGRLYLSDNKIRD-IEKDTFVNL----LLLQFLD 801

  Fly    89 LEHNNLTSVP---ILPKYDVENLYLANNQIDSISVGAFQNLTELVTLDLSHNRLTSKVLVPDVFK 150
            |..|.|..:.   ..|..|:|.|.||.|.|::|...||..|..|.:||||||.|..  |..|:|.
  Fly   802 LSGNQLRQLRRDYFAPLQDLEELSLARNHIEAIEGYAFAKLKNLKSLDLSHNPLVQ--LTRDIFS 864

  Fly   151 GPFTVQD---------------FESLENLKTLNLGYNDLHSLDADLFEHIPHIEELVLCSNSFHV 200
            ..|.:..               |:||.||..|||..|.|:..|....: ||::..|:|..|:|..
  Fly   865 NEFPLNSLNLGNCSLRKLEQHAFKSLTNLNELNLERNQLNPADIQTLD-IPNLRRLLLSHNNFSY 928

  Fly   201 IDQLSETA--ISGLQSLKILDVSYMEIDDLPDTILHGPRDLEIFIAAGNLFNQLPKALKYATNLT 263
            ...:...|  :..|:||:.|.:|...:..:||.:.           |.|            |||.
  Fly   929 AGSVGIMAGMLDRLRSLQQLSMSNCSLGQIPDLLF-----------AKN------------TNLV 970

  Fly   264 SLVLNENPIENL-----IGDNVFP-------PLTKLTHLSMTFMSKLYKIGPGAFSELQS----- 311
            .|.|.:|.:..:     .|.|||.       .|:...|:::..:|.|..:.. |.::|.|     
  Fly   971 RLDLCDNRLTQINRNIFSGLNVFKELRLCRNELSDFPHIALYNLSTLESLDL-ARNQLASIDFFK 1034

  Fly   312 ------LTELILSDNKL----------LNEIDEEALSKNVTGGQYLDYPP--------LEKVYLN 352
                  |.:|||.|||:          |.::|    |.:::|...|..|.        |:||:|:
  Fly  1035 LSGTLNLRQLILRDNKITALSGFNAVNLTQLD----SVDLSGNLLLSLPANFLRHSINLQKVHLS 1095

  Fly   353 NCNVSTLPKELL--VRWDKLKALDLRFNPWN------------------CD------ESNDF--- 388
            |.....:|...|  |...:|..|:|..||.|                  |.      .|.||   
  Fly  1096 NNRFLQIPSSALSDVSIPRLSWLNLTGNPINRIYTVKEERYPYLKELYICQTNLSILTSKDFEAF 1160

  Fly   389 -------LINVLIDRIN-----KTTPVLAKDVKCG-----GPNKLNDVTLLRVAN 426
                   |:|..|.||:     ..|.:|..|:...     ...:|..:.|||..|
  Fly  1161 QALQHLHLVNNRITRISPGAFKSLTNLLTLDLSVNELEMLPKERLQGLRLLRFLN 1215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5096NP_723576.1 LRR_RI 69..378 CDD:238064 96/371 (26%)
leucine-rich repeat 85..104 CDD:275380 4/21 (19%)
LRR_8 105..174 CDD:290566 31/83 (37%)
leucine-rich repeat 105..128 CDD:275380 10/22 (45%)
leucine-rich repeat 129..163 CDD:275380 15/48 (31%)
LRR_8 163..222 CDD:290566 19/60 (32%)
leucine-rich repeat 164..187 CDD:275380 8/22 (36%)
leucine-rich repeat 188..214 CDD:275380 6/27 (22%)
leucine-rich repeat 215..238 CDD:275380 5/22 (23%)
leucine-rich repeat 239..261 CDD:275380 2/21 (10%)
LRR_8 260..322 CDD:290566 23/84 (27%)
leucine-rich repeat 262..286 CDD:275380 9/35 (26%)
leucine-rich repeat 287..311 CDD:275380 5/23 (22%)
leucine-rich repeat 346..369 CDD:275380 8/24 (33%)
leucine-rich repeat 370..388 CDD:275380 8/41 (20%)
CG42346NP_001036303.2 leucine-rich repeat 303..325 CDD:275380
LRR_8 325..384 CDD:290566
leucine-rich repeat 327..350 CDD:275380
leucine-rich repeat 351..461 CDD:275380
LRR_8 373..433 CDD:290566
LRR_RI 397..648 CDD:238064
leucine-rich repeat 399..422 CDD:275380
leucine-rich repeat 462..485 CDD:275380
LRR_8 465..520 CDD:290566
leucine-rich repeat 486..509 CDD:275380
LRR_8 508..567 CDD:290566
leucine-rich repeat 510..533 CDD:275380
LRR_RI 527..785 CDD:238064 8/42 (19%)
leucine-rich repeat 534..556 CDD:275380
LRR_8 555..613 CDD:290566
leucine-rich repeat 557..580 CDD:275380
leucine-rich repeat 581..604 CDD:275380
LRR_8 604..663 CDD:290566
leucine-rich repeat 605..628 CDD:275380
leucine-rich repeat 629..652 CDD:275380
LRR_8 652..711 CDD:290566
leucine-rich repeat 653..676 CDD:275380
leucine-rich repeat 677..700 CDD:275380
leucine-rich repeat 701..748 CDD:275380 1/5 (20%)
leucine-rich repeat 725..736 CDD:275378
leucine-rich repeat 749..772 CDD:275380 4/22 (18%)
LRR_8 771..831 CDD:290566 14/64 (22%)
leucine-rich repeat 773..793 CDD:275380 3/20 (15%)
LRR_RI 804..1076 CDD:238064 81/302 (27%)
LRR_8 821..903 CDD:290566 31/83 (37%)
leucine-rich repeat 821..844 CDD:275380 10/22 (45%)
leucine-rich repeat 845..868 CDD:275380 11/24 (46%)
leucine-rich repeat 869..892 CDD:275380 3/22 (14%)
leucine-rich repeat 893..915 CDD:275380 8/22 (36%)
leucine-rich repeat 916..944 CDD:275380 6/27 (22%)
leucine-rich repeat 945..968 CDD:275380 7/45 (16%)
LRR_8 967..1027 CDD:290566 15/60 (25%)
leucine-rich repeat 969..992 CDD:275380 5/22 (23%)
leucine-rich repeat 993..1014 CDD:275380 3/20 (15%)
LRR_8 1015..1075 CDD:290566 16/64 (25%)
leucine-rich repeat 1017..1040 CDD:275380 4/23 (17%)
leucine-rich repeat 1041..1064 CDD:275380 8/22 (36%)
LRR_RI <1047..1244 CDD:238064 40/173 (23%)
LRR_8 1063..1125 CDD:290566 17/65 (26%)
leucine-rich repeat 1089..1114 CDD:275380 8/24 (33%)
leucine-rich repeat 1115..1162 CDD:275380 10/46 (22%)
LRR_8 1163..1219 CDD:290566 13/53 (25%)
leucine-rich repeat 1163..1186 CDD:275380 5/22 (23%)
leucine-rich repeat 1187..1210 CDD:275380 3/22 (14%)
leucine-rich repeat 1211..1233 CDD:275380 3/5 (60%)
leucine-rich repeat 1234..1257 CDD:275380
LRR_8 1235..1292 CDD:290566
leucine-rich repeat 1258..1279 CDD:275380
leucine-rich repeat 1282..1306 CDD:275380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45617
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.