Sequence 1: | NP_723576.1 | Gene: | CG5096 / 34410 | FlyBaseID: | FBgn0032235 | Length: | 491 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_796126.4 | Gene: | Lrig3 / 320398 | MGIID: | 2443955 | Length: | 1117 | Species: | Mus musculus |
Alignment Length: | 482 | Identity: | 103/482 - (21%) |
---|---|---|---|
Similarity: | 181/482 - (37%) | Gaps: | 142/482 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 KSATLA-AAIFCIVLSQVS----------GQTKDETTTTETPKEKIKVIDSKLCKKCNCYIDTNL 58
Fly 59 LDCSEK--------LQDW-----------------------------LSAEDWEDLTN------- 79
Fly 80 -------GNVVFK-------------TINLEHNNLTSV-PILPKYDVENLYLANNQIDSISVGAF 123
Fly 124 QNL-TELVTLDLSHNRLTSKVLVPDVFKGPFTVQDFESLENLKTLNLGYNDLHSLDADLFEHIPH 187
Fly 188 IEELVLCSNSFHVIDQLSETAISGLQSLKILDVSYMEIDDLPDTILHGPRDLEIFIAAGNLFNQL 252
Fly 253 -PKALKYATNLTSLVLNENPIENL---------------IGDN--------VFPPLTKLTHLSM- 292
Fly 293 -TFMSKLYKIGPGAFSELQSLTELILSDNKLLNEIDEEALSKNVTGGQYLDYPPLEKVYLNNCNV 356
Fly 357 STLPKELLVRWDKLKALDLRFNPWNCD 383 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5096 | NP_723576.1 | LRR_RI | 69..378 | CDD:238064 | 82/363 (23%) |
leucine-rich repeat | 85..104 | CDD:275380 | 6/32 (19%) | ||
LRR_8 | 105..174 | CDD:290566 | 22/69 (32%) | ||
leucine-rich repeat | 105..128 | CDD:275380 | 9/23 (39%) | ||
leucine-rich repeat | 129..163 | CDD:275380 | 9/33 (27%) | ||
LRR_8 | 163..222 | CDD:290566 | 13/58 (22%) | ||
leucine-rich repeat | 164..187 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 188..214 | CDD:275380 | 6/25 (24%) | ||
leucine-rich repeat | 215..238 | CDD:275380 | 3/22 (14%) | ||
leucine-rich repeat | 239..261 | CDD:275380 | 5/22 (23%) | ||
LRR_8 | 260..322 | CDD:290566 | 24/86 (28%) | ||
leucine-rich repeat | 262..286 | CDD:275380 | 10/46 (22%) | ||
leucine-rich repeat | 287..311 | CDD:275380 | 8/25 (32%) | ||
leucine-rich repeat | 346..369 | CDD:275380 | 4/22 (18%) | ||
leucine-rich repeat | 370..388 | CDD:275380 | 5/14 (36%) | ||
Lrig3 | NP_796126.4 | LRR 1 | 75..98 | 1/22 (5%) | |
LRR_8 | 76..133 | CDD:290566 | 5/56 (9%) | ||
leucine-rich repeat | 76..99 | CDD:275378 | 0/22 (0%) | ||
LRR_RI | 81..324 | CDD:238064 | 53/257 (21%) | ||
LRR 2 | 99..120 | 3/20 (15%) | |||
leucine-rich repeat | 100..146 | CDD:275378 | 6/45 (13%) | ||
LRR_8 | 122..179 | CDD:290566 | 12/56 (21%) | ||
LRR 3 | 122..143 | 3/20 (15%) | |||
LRR 4 | 146..168 | 5/21 (24%) | |||
leucine-rich repeat | 147..168 | CDD:275380 | 5/20 (25%) | ||
LRR_8 | 168..227 | CDD:290566 | 22/70 (31%) | ||
leucine-rich repeat | 169..192 | CDD:275380 | 9/22 (41%) | ||
LRR 5 | 169..189 | 7/19 (37%) | |||
LRR 6 | 193..214 | 8/32 (25%) | |||
leucine-rich repeat | 194..216 | CDD:275380 | 9/33 (27%) | ||
LRR_8 | 215..275 | CDD:290566 | 13/62 (21%) | ||
LRR 7 | 216..237 | 6/20 (30%) | |||
leucine-rich repeat | 217..240 | CDD:275380 | 6/22 (27%) | ||
LRR 8 | 240..261 | 4/23 (17%) | |||
leucine-rich repeat | 241..264 | CDD:275380 | 6/25 (24%) | ||
LRR_RI | 262..>446 | CDD:238064 | 42/193 (22%) | ||
LRR_8 | 263..323 | CDD:290566 | 12/59 (20%) | ||
LRR 9 | 264..285 | 2/20 (10%) | |||
leucine-rich repeat | 265..288 | CDD:275380 | 3/22 (14%) | ||
LRR 10 | 288..309 | 5/20 (25%) | |||
leucine-rich repeat | 289..312 | CDD:275380 | 5/22 (23%) | ||
LRR_8 | 312..371 | CDD:290566 | 13/58 (22%) | ||
LRR 11 | 312..333 | 5/20 (25%) | |||
leucine-rich repeat | 313..336 | CDD:275380 | 5/22 (23%) | ||
LRR 12 | 336..357 | 4/20 (20%) | |||
leucine-rich repeat | 337..360 | CDD:275380 | 5/22 (23%) | ||
LRR_8 | 359..422 | CDD:290566 | 18/72 (25%) | ||
LRR 13 | 360..382 | 4/21 (19%) | |||
leucine-rich repeat | 361..385 | CDD:275380 | 7/23 (30%) | ||
LRR 14 | 387..408 | 6/30 (20%) | |||
leucine-rich repeat | 388..411 | CDD:275380 | 6/32 (19%) | ||
LRR 15 | 411..432 | 4/20 (20%) | |||
leucine-rich repeat | 412..433 | CDD:275380 | 4/20 (20%) | ||
LRRCT | 446..494 | CDD:214507 | 2/4 (50%) | ||
I-set | 499..599 | CDD:254352 | |||
Ig | 500..587 | CDD:299845 | |||
I-set | 603..693 | CDD:254352 | |||
Ig_1 | 620..694 | CDD:143240 | |||
I-set | 697..784 | CDD:254352 | |||
IGc2 | 711..774 | CDD:197706 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1019..1093 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |