DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5096 and Lingo1

DIOPT Version :10

Sequence 1:NP_723576.1 Gene:CG5096 / 34410 FlyBaseID:FBgn0032235 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001094192.1 Gene:Lingo1 / 315691 RGDID:1308668 Length:620 Species:Rattus norvegicus


Alignment Length:358 Identity:85/358 - (23%)
Similarity:144/358 - (40%) Gaps:84/358 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 DTNLLDCSEKLQDWLSAEDW------EDL-TNGNVVFKTINLEHNNLTSVPILPKYDVENLYLAN 112
            :|.|||..:.....|:.:::      |:| .|.|:|........|||        :::..|.|.:
  Rat    72 ETRLLDLGKNRIKTLNQDEFASFPHLEELELNENIVSAVEPGAFNNL--------FNLRTLGLRS 128

  Fly   113 NQIDSISVGAFQNLTELVTLDLSHNRLTSKVLVPDVFKGPFTVQDFESLENLKTLNLGYNDLHSL 177
            |::..|.:|.|..|:.|..||:|.|::   |::.|..        |:.|.|||:|.:|.|||..:
  Rat   129 NRLKLIPLGVFTGLSNLTKLDISENKI---VILLDYM--------FQDLYNLKSLEVGDNDLVYI 182

  Fly   178 DADLFEHIPHIEELVL--CS---------NSFH----------VIDQLSETAISGLQSLKILDVS 221
            ....|..:..:|:|.|  |:         :..|          .|:.:.:.:...|..||:|::|
  Rat   183 SHRAFSGLNSLEQLTLEKCNLTSIPTEALSHLHGLIVLRLRHLNINAIRDYSFKRLYRLKVLEIS 247

  Fly   222 YME-IDDLPDTILHGPRDLEIFIAAGNLFNQLPKALKYATNLTSLVLNENPIENLIGDNVFPPLT 285
            :.. :|.:....|:|.....:.|...||......|:::...|..|.|:.|||..:.| ::...|.
  Rat   248 HWPYLDTMTPNCLYGLNLTSLSITHCNLTAVPYLAVRHLVYLRFLNLSYNPIGTIEG-SMLHELL 311

  Fly   286 KLTHLSMTFMSKLYKIGPGAFSELQSLTELILSDNKLLNEIDEEALSKNVTGGQYLDYPPLEKVY 350
            :|..:.:. ..:|..:.|.||..|..|..|                  ||:|.|           
  Rat   312 RLQEIQLV-GGQLAVVEPYAFRGLNYLRVL------------------NVSGNQ----------- 346

  Fly   351 LNNCNVSTLPKELLVRWDKLKALDLRFNPWNCD 383
                 ::||.:........|:.|.|..||..||
  Rat   347 -----LTTLEESAFHSVGNLETLILDSNPLACD 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5096NP_723576.1 LRR 54..>322 CDD:443914 72/295 (24%)
leucine-rich repeat 85..104 CDD:275380 3/18 (17%)
leucine-rich repeat 105..128 CDD:275380 7/22 (32%)
leucine-rich repeat 129..163 CDD:275380 9/33 (27%)
leucine-rich repeat 164..187 CDD:275380 8/22 (36%)
leucine-rich repeat 188..214 CDD:275380 7/46 (15%)
leucine-rich repeat 215..238 CDD:275380 7/23 (30%)
leucine-rich repeat 239..261 CDD:275380 4/21 (19%)
leucine-rich repeat 262..286 CDD:275380 8/23 (35%)
leucine-rich repeat 287..311 CDD:275380 6/23 (26%)
leucine-rich repeat 346..369 CDD:275380 2/22 (9%)
leucine-rich repeat 370..388 CDD:275380 7/14 (50%)
Lingo1NP_001094192.1 LRRNT 41..75 CDD:214470 1/2 (50%)
LRR 71..>371 CDD:443914 82/353 (23%)
leucine-rich repeat 73..96 CDD:275380 5/22 (23%)
leucine-rich repeat 97..120 CDD:275380 8/30 (27%)
leucine-rich repeat 121..144 CDD:275380 7/22 (32%)
leucine-rich repeat 145..192 CDD:275380 18/57 (32%)
leucine-rich repeat 193..216 CDD:275380 4/22 (18%)
leucine-rich repeat 217..264 CDD:275380 9/46 (20%)
leucine-rich repeat 265..288 CDD:275380 4/22 (18%)
leucine-rich repeat 289..312 CDD:275380 8/23 (35%)
leucine-rich repeat 313..336 CDD:275380 6/23 (26%)
leucine-rich repeat 337..357 CDD:275380 8/53 (15%)
PCC 341..>421 CDD:188093 13/50 (26%)
IgI_Lingo-1 423..514 CDD:409561
Ig strand A 423..426 CDD:409561
Ig strand A' 431..435 CDD:409561
Ig strand B 441..450 CDD:409561
Ig strand C 455..460 CDD:409561
Ig strand C' 463..465 CDD:409561
Ig strand D 474..477 CDD:409561
Ig strand E 480..487 CDD:409561
Ig strand F 493..501 CDD:409561
Ig strand G 504..514 CDD:409561
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.