DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5096 and Lrrc4c

DIOPT Version :9

Sequence 1:NP_723576.1 Gene:CG5096 / 34410 FlyBaseID:FBgn0032235 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_001101223.1 Gene:Lrrc4c / 311236 RGDID:1311013 Length:640 Species:Rattus norvegicus


Alignment Length:351 Identity:84/351 - (23%)
Similarity:144/351 - (41%) Gaps:93/351 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 VIDSKLCKK-CNCYIDTNLLDCSEK----LQDWLSAEDWEDLTNGNVVFKTINLEHNNLTSVPIL 100
            ::.::.|.. |:|....:.:.|..|    :.|.:|       ||    .:.:||..|.:..:.:.
  Rat    41 LVRAQTCPSVCSCSNQFSKVICVRKNLREVPDGIS-------TN----TRLLNLHENQIQIIKVN 94

  Fly   101 P-KY--DVENLYLANNQIDSISVGAFQNLTELVTLDLSHNRLTSKVLVPDVFKGPFTVQDFESLE 162
            . |:  .:|.|.|:.|.|.:|.:|||..|..|.||:|..||||:   :|:   |.|..     |.
  Rat    95 SFKHLRHLEILQLSRNHIRTIEIGAFNGLANLNTLELFDNRLTT---IPN---GAFVY-----LS 148

  Fly   163 NLKTLNLGYNDLHSLDADLFEHIPHIEELVLCSNSFHVIDQLSETAISGLQSLKILDVSYMEIDD 227
            .||.|.|..|.:.|:.:..|..||.:..|.|  .....:..:||.|..||.:|:.|:::...:.:
  Rat   149 KLKELWLRNNPIESIPSYAFNRIPSLRRLDL--GELKRLSYISEGAFEGLSNLRYLNLAMCNLRE 211

  Fly   228 LPDTILHGPRDLEIFIAAGNLFNQLPKALKYATNLTSLVLNENPIENLIGDNVFPPLTKLTHLSM 292
            :|                               |||                   ||.||..|.:
  Rat   212 IP-------------------------------NLT-------------------PLIKLDELDL 226

  Fly   293 TFMSKLYKIGPGAFSELQSLTELILSDNKLLNEIDEEALSKNVTGGQYLDYPPLEKVYLNNCNVS 357
            : .:.|..|.||:|..|..|.:|.:..:::      :.:.:|.    :.:...|.::.|.:.|::
  Rat   227 S-GNHLSAIRPGSFQGLMHLQKLWMIQSQI------QVIERNA----FDNLQSLVEINLAHNNLT 280

  Fly   358 TLPKELLVRWDKLKALDLRFNPWNCD 383
            .||.:|......|:.:.|..|||||:
  Rat   281 LLPHDLFTPLHHLERIHLHHNPWNCN 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5096NP_723576.1 LRR_RI 69..378 CDD:238064 73/311 (23%)
leucine-rich repeat 85..104 CDD:275380 4/21 (19%)
LRR_8 105..174 CDD:290566 27/68 (40%)
leucine-rich repeat 105..128 CDD:275380 10/22 (45%)
leucine-rich repeat 129..163 CDD:275380 12/33 (36%)
LRR_8 163..222 CDD:290566 18/58 (31%)
leucine-rich repeat 164..187 CDD:275380 8/22 (36%)
leucine-rich repeat 188..214 CDD:275380 7/25 (28%)
leucine-rich repeat 215..238 CDD:275380 3/22 (14%)
leucine-rich repeat 239..261 CDD:275380 0/21 (0%)
LRR_8 260..322 CDD:290566 16/61 (26%)
leucine-rich repeat 262..286 CDD:275380 4/23 (17%)
leucine-rich repeat 287..311 CDD:275380 8/23 (35%)
leucine-rich repeat 346..369 CDD:275380 6/22 (27%)
leucine-rich repeat 370..388 CDD:275380 7/14 (50%)
Lrrc4cNP_001101223.1 LRRNT 47..80 CDD:214470 9/43 (21%)
PPP1R42 65..235 CDD:411060 59/244 (24%)
leucine-rich repeat 78..101 CDD:275380 4/22 (18%)
leucine-rich repeat 102..125 CDD:275380 10/22 (45%)
leucine-rich repeat 126..149 CDD:275380 12/33 (36%)
leucine-rich repeat 150..173 CDD:275380 8/22 (36%)
leucine-rich repeat 174..198 CDD:275380 7/25 (28%)
leucine-rich repeat 199..220 CDD:275380 8/70 (11%)
LRR_8 220..279 CDD:404697 14/69 (20%)
leucine-rich repeat 221..244 CDD:275380 8/23 (35%)
leucine-rich repeat 245..268 CDD:275380 3/32 (9%)
LRR_8 267..>301 CDD:404697 8/33 (24%)
leucine-rich repeat 269..290 CDD:275380 6/20 (30%)
LRRCT 301..>339 CDD:214507 5/6 (83%)
IG 360..443 CDD:214652
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.