DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5096 and Chad

DIOPT Version :9

Sequence 1:NP_723576.1 Gene:CG5096 / 34410 FlyBaseID:FBgn0032235 Length:491 Species:Drosophila melanogaster
Sequence 2:NP_062037.1 Gene:Chad / 29195 RGDID:2336 Length:358 Species:Rattus norvegicus


Alignment Length:398 Identity:86/398 - (21%)
Similarity:146/398 - (36%) Gaps:100/398 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 KKCNCYIDTNLLDCSEKLQDWLSAEDWEDLTNGNVVFKTINLEHNNLTSVPILPKY------DVE 106
            :.|:|:.|...:.|.:        ...:.:...:...|.:||:.||.   |:|...      ::.
  Rat    24 QNCHCHGDLQHVICDK--------VGLQKIPKVSETTKLLNLQRNNF---PVLAANSFRTVPNLV 77

  Fly   107 NLYLANNQIDSISVGAFQNLTELVTLDLSHNRLTSKVLVPDVFKGPFTVQDFESLENLKTLNLGY 171
            :|:|.:..|..::.|||:.|.:|:.|.|||                                   
  Rat    78 SLHLQHCNIREVAAGAFRGLKQLIYLYLSH----------------------------------- 107

  Fly   172 NDLHSLDADLFEHIPHIEELVLCSNSFHVIDQLSETAISGLQSLKILDVSYMEIDDLPDTILHGP 236
            ||:..|.|..|:.:..:..|.|..|.   :.:|....:|.|.:|.||.::..:|.:|......|.
  Rat   108 NDIRVLRAGAFDDLTELTYLYLDHNK---VSELPRGLLSPLVNLFILQLNNNKIRELRAGAFQGA 169

  Fly   237 RDLE-IFIAAGNLFNQLPKALKYATNLTSLVLNENPIENLIGDNVFPPLT----------KLTHL 290
            :||. ::::...|.:..|.:|....||....|:.|.:.:      :|...          ||:| 
  Rat   170 KDLRWLYLSENALTSLHPGSLDDVENLAKFHLDRNQLSS------YPSAALSKLRVVEELKLSH- 227

  Fly   291 SMTFMSKLYKIGPGAFSELQSLTELILSDNKLLNEIDEEALSKNVTGGQYLDYPPLEKVYLNNCN 355
                 :.|..|...||.......|.:..||..|.:..:.|.:...|         |:.|:|.|..
  Rat   228 -----NPLKSIPDNAFQSFGRYLETLWLDNTNLEKFSDAAFAGVTT---------LKHVHLENNR 278

  Fly   356 VSTLPKELLVRWDKLKALDLRFNPWNCDESNDFLINVLIDRINKTTPVLAKDVKCGGPNK----- 415
            ::.||...  .:|.|:.|.|..|||.|......|...|..:.::      .|..|..|.|     
  Rat   279 LNQLPSTF--PFDNLETLTLTNNPWKCTCQLRGLRRWLEAKTSR------PDATCSSPAKFKGQR 335

  Fly   416 LNDVTLLR 423
            :.|...||
  Rat   336 IRDTDALR 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5096NP_723576.1 LRR_RI 69..378 CDD:238064 69/325 (21%)
leucine-rich repeat 85..104 CDD:275380 7/24 (29%)
LRR_8 105..174 CDD:290566 13/68 (19%)
leucine-rich repeat 105..128 CDD:275380 7/22 (32%)
leucine-rich repeat 129..163 CDD:275380 5/33 (15%)
LRR_8 163..222 CDD:290566 14/58 (24%)
leucine-rich repeat 164..187 CDD:275380 5/22 (23%)
leucine-rich repeat 188..214 CDD:275380 6/25 (24%)
leucine-rich repeat 215..238 CDD:275380 6/22 (27%)
leucine-rich repeat 239..261 CDD:275380 4/22 (18%)
LRR_8 260..322 CDD:290566 15/71 (21%)
leucine-rich repeat 262..286 CDD:275380 4/33 (12%)
leucine-rich repeat 287..311 CDD:275380 6/23 (26%)
leucine-rich repeat 346..369 CDD:275380 6/22 (27%)
leucine-rich repeat 370..388 CDD:275380 7/17 (41%)
ChadNP_062037.1 LRRNT 22..48 CDD:279764 4/31 (13%)
LRR 1 51..72 7/23 (30%)
leucine-rich repeat 52..75 CDD:275380 7/25 (28%)
LRR_8 74..134 CDD:290566 20/97 (21%)
LRR 2 75..96 6/20 (30%)
leucine-rich repeat 76..99 CDD:275380 7/22 (32%)
LRR_RI <89..281 CDD:238064 53/250 (21%)
LRR 3 99..120 10/55 (18%)
leucine-rich repeat 100..123 CDD:275380 10/57 (18%)
LRR 4 123..144 4/23 (17%)
leucine-rich repeat 124..147 CDD:275380 6/25 (24%)
LRR_8 147..206 CDD:290566 15/58 (26%)
LRR 5 147..168 5/20 (25%)
leucine-rich repeat 148..171 CDD:275380 6/22 (27%)
LRR 6 171..192 5/20 (25%)
leucine-rich repeat 172..195 CDD:275380 4/22 (18%)
LRR_8 195..255 CDD:290566 15/71 (21%)
LRR 7 195..216 5/26 (19%)
leucine-rich repeat 196..219 CDD:275380 4/28 (14%)
LRR 8 219..240 7/26 (27%)
leucine-rich repeat 220..243 CDD:275380 7/28 (25%)
LRR_8 243..300 CDD:290566 16/67 (24%)
LRR 9 244..265 5/20 (25%)
leucine-rich repeat 245..268 CDD:275380 5/22 (23%)
LRR 10 268..289 7/31 (23%)
LRRCT 299..346 CDD:214507 13/51 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 321..358 7/23 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D334557at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.