Sequence 1: | NP_723576.1 | Gene: | CG5096 / 34410 | FlyBaseID: | FBgn0032235 | Length: | 491 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_491676.2 | Gene: | lron-8 / 181983 | WormBaseID: | WBGene00020693 | Length: | 341 | Species: | Caenorhabditis elegans |
Alignment Length: | 264 | Identity: | 69/264 - (26%) |
---|---|---|---|
Similarity: | 112/264 - (42%) | Gaps: | 66/264 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 51 NCYIDTNLLDCS--------EKLQDWLSAEDWE------DLTNGNVVFKTINLEHNNLTSVPILP 101
Fly 102 KYDVENLYLANNQIDSISVGAFQNLTELVTLDLSHNRLTSKVLVPDVFKGPFTVQDFESLENLKT 166
Fly 167 LNLGYNDLHSLDADLFEHIPHIEELVLCSNSF-HV---------IDQLSETAISGLQSLKILDVS 221
Fly 222 YMEID--DLPDTILHGPRDLEIFIAAGNLFNQLPKAL-KYATNLTSLVLNENPIE-------NLI 276
Fly 277 GDNV 280 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG5096 | NP_723576.1 | LRR_RI | 69..378 | CDD:238064 | 63/238 (26%) |
leucine-rich repeat | 85..104 | CDD:275380 | 5/18 (28%) | ||
LRR_8 | 105..174 | CDD:290566 | 19/68 (28%) | ||
leucine-rich repeat | 105..128 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 129..163 | CDD:275380 | 8/33 (24%) | ||
LRR_8 | 163..222 | CDD:290566 | 17/68 (25%) | ||
leucine-rich repeat | 164..187 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 188..214 | CDD:275380 | 6/35 (17%) | ||
leucine-rich repeat | 215..238 | CDD:275380 | 7/24 (29%) | ||
leucine-rich repeat | 239..261 | CDD:275380 | 6/22 (27%) | ||
LRR_8 | 260..322 | CDD:290566 | 10/28 (36%) | ||
leucine-rich repeat | 262..286 | CDD:275380 | 10/26 (38%) | ||
leucine-rich repeat | 287..311 | CDD:275380 | |||
leucine-rich repeat | 346..369 | CDD:275380 | |||
leucine-rich repeat | 370..388 | CDD:275380 | |||
lron-8 | NP_491676.2 | LRR | <71..>237 | CDD:227223 | 51/196 (26%) |
leucine-rich repeat | 75..98 | CDD:275380 | 7/35 (20%) | ||
leucine-rich repeat | 99..122 | CDD:275380 | 8/33 (24%) | ||
leucine-rich repeat | 123..158 | CDD:275380 | 12/38 (32%) | ||
leucine-rich repeat | 159..179 | CDD:275380 | 2/19 (11%) | ||
leucine-rich repeat | 180..202 | CDD:275380 | 7/24 (29%) | ||
leucine-rich repeat | 203..226 | CDD:275380 | 6/22 (27%) | ||
LRRCT | 235..282 | CDD:214507 | 7/18 (39%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C160160055 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |